SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002838 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002838
Domain Number 1 Region: 821-929
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 510-613
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 620-717
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 148-264
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-20
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 1043-1155
Classification Level Classification E-value
Superfamily Cadherin-like 2e-17
Family Cadherin 0.002
Further Details:      
 
Domain Number 6 Region: 748-821
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-17
Family Cadherin 0.0031
Further Details:      
 
Domain Number 7 Region: 925-1039
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-17
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 1143-1254
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-16
Family Cadherin 0.0023
Further Details:      
 
Domain Number 9 Region: 396-516
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000171
Family Cadherin 0.0077
Further Details:      
 
Domain Number 10 Region: 308-394
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000143
Family Cadherin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002838   Gene: ENSTNIG00000008618   Transcript: ENSTNIT00000002245
Sequence length 1409
Comment pep:known_by_projection chromosome:TETRAODON8:17:6658824:6724063:1 gene:ENSTNIG00000008618 transcript:ENSTNIT00000002245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKMQQGRWLIGCLGAVMAIFSLINHSWGQDTEDWQYEECKLSRPGPPATIVTIDEESPNG
TVLVENMQINGRAQDPGRTISLTLLDNYDYWVILEPGRQRLYLNSTGRVLDRDPPNYITT
IVVQVQCTNELVGTVIFHEVRIVVRDKNDNTPRFQQPRYYVAVNELTPVGTTIFTGFSGN
NGATDIDDGPNGHIEYSILYNPNDPESNRTVSVGNTLSGYIILAERLNYEERTRYLVVVQ
ANDRAPYPPNRRTATTTLTVDVLDGDDLGPMFLPCVLVNNTRDCNPLSYRAAIPEFTEPS
KLNPLNVTPLIRAVDMDRNIQPPSDRPGILYYILVGHPATYAEYFSLNKTTAELRVLQPI
NRDLYQRFTLIIKAEQDNGHPLPAFADLIIEILDENNQAPYFQLATYQGYVSESSPVGAT
ISASANLTTPLEIIALDNDIEETKDPLVKITLGDYTTVFGVTQTGITRYLRLVTPVDREK
QMTYTFTMVASDGVQQSSPVTVNILVIDANDNTPTFAKVSYNVEVFTNMQPGETVLQLTA
ADADEGLNGLVTYEILAGAQGHFIINNRTGRLTVAPGVALMVGQSYALTVKASDGAPETQ
RRSSITTVYIEVLPPNNQSPPRFPLLTYSLEVSEAMRIGAILLNLQATDRENDPITYRII
SGDTQQVFNLSETIGLLILRKPLDRERTDQYRLIVTASDGNPGGTSTTTVNIVVTDVNDA
SGFMDLLLPLIVIVRRKTADSFAGGGFPQATDPDAGPNGQIGYRIINHPDLFLISENGSI
YTKVRLDRELQSHYDLVVEASDGAVDPRRTTLTLSIQVTDIDDNSPVFSQQNYVVNVPEN
SPVGTVVLNLSATDADLVSNVTYRIRTDAARQLFSLNPITGELAVLQTLDFEDLAALGIG
TSYSFQVEAVDQGGLMPPGQATVTVRITDMNDFSPVFSQDLYKGMVAPNAEKGTVITTVL
AEDQDPPGTPASFVRYRVDLDRSPYSGSIFDVEKETGRIVTKVNLNEEPSVTFKLFVVAF
DDGEPVKTNSTLVEITVLQPSRIPIFTQEEYRFSPVSELAPFDTPVGTVLAAAVNQTIFY
SIVGGNDLGHFQINNKTGVISTAKPLDYEAVTSYVLRVQADSMEVVMSNLRVPSKTNTAK
VFIEVQDENDHSPVFSRKLYIGGVTEDTKIFSSVLKIVATDKDTGNYSMMAYRLIIPPTQ
EGQDSFVIETYTGIIKSAIMFRNMRRSYFKFQVIATDDYGTGLSSSAEVVVSGLGRGSCH
VINFNTPVKDCADFMFSILERHVQDQIPGAKVIVESIGPRRHGDGFELEDYTKSDLMVYA
IDPLTNRAISPKELFKFLDGNVLEINKEFQPYLGEGGRILEIRSPDIVASVKKAAQAVGY
TEGALLALAIIIILCCIPAILIVMVTYKQ
Download sequence
Identical sequences H3C3L9
99883.ENSTNIP00000002838 ENSTNIP00000002838 ENSTNIP00000002838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]