SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002847 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002847
Domain Number 1 Region: 917-989
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.01e-18
Family TB module/8-cys domain 0.00078
Further Details:      
 
Domain Number 2 Region: 2305-2377
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-18
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 3 Region: 2420-2548
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 4 Region: 1820-1956
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 286-356
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.71e-17
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 6 Region: 2102-2228
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 993-1123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.26e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 8 Region: 140-225
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.23e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 9 Region: 1657-1723
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000131
Family TB module/8-cys domain 0.0008
Further Details:      
 
Domain Number 10 Region: 2022-2085
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000151
Family TB module/8-cys domain 0.00014
Further Details:      
 
Domain Number 11 Region: 1495-1570
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000235
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 12 Region: 617-690
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000222
Family TB module/8-cys domain 0.00092
Further Details:      
 
Domain Number 13 Region: 1092-1208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000004
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 14 Region: 813-896
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000051
Family TB module/8-cys domain 0.0027
Further Details:      
 
Domain Number 15 Region: 411-538
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000675
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 16 Region: 1285-1421
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000137
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 17 Region: 540-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000419
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 2376-2430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000466
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 19 Region: 1207-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000935
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 20 Region: 1578-1625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000115
Family EGF-type module 0.00085
Further Details:      
 
Domain Number 21 Region: 688-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000012
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 22 Region: 1980-2027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000189
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 23 Region: 1737-1787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000023
Family EGF-type module 0.0026
Further Details:      
 
Domain Number 24 Region: 2545-2660
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000455
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 25 Region: 2259-2307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000015
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 26 Region: 729-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000527
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 27 Region: 1945-1982
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000888
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 28 Region: 245-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000107
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 29 Region: 1421-1505
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000011
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 30 Region: 1781-1816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000513
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 31 Region: 1619-1662
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000592
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 32 Region: 775-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000839
Family EGF-type module 0.018
Further Details:      
 
Domain Number 33 Region: 2219-2265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000305
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002847
Domain Number - Region: 111-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000182
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 77-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0408
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002847   Gene: ENSTNIG00000009530   Transcript: ENSTNIT00000002747
Sequence length 2841
Comment pep:known_by_projection chromosome:TETRAODON8:5:10108510:10147222:-1 gene:ENSTNIG00000009530 transcript:ENSTNIT00000002747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RASRAKRRGGADVLRGPNVCGSRNNAYCCPGWKTLTGGNQCIVPICRSSCGDGFCSRPNM
CTCPTGQTALSCGSKSVQNCNIRCMNGGTCAEDHCLCQKGYIGKHCGQPVCENGCLNGGR
CVAPNRCVCPYGFTGAQCERDYRTGPCFASVDNQVCQGQLTGIVCTKTLCCATVGRAWGH
PCEMCPAQPNPCRRGFIPNHRTGACQDVDECQAIPGICQGGNCINTVGSFECKCPAGHRF
SELSQKCDDLDECSNIPGLCGVGECSNTIGSYFCKCPQGYFTSMDGSRCIDIRSGYCYTS
VLNGRCANQNSQLMSKIQCCCDSGRCWADGSLPEMCPIPGTEEYRKLCIQFPDGTNGVLI
PGRVPGGPELPGIYPVQYPGHTPGVVPGQVPGVIPGQIPIPGQIPVPGTQNITNLCQAYR
NLCQNGRCIPVPGEIRYRCECNMGYRLNGRGECFDDDECERNPCAHGECVNTPGSYICQC
PAGFQSTSTRTECADLDECVANGRICNNGRCVNTEGSFHCVCNAGFEISADGKNCQDQDE
CLIRNMCLNGLCINEDGSFKCICKPGYLLDSSGRMCIDIDECETPGMCMNGRCINTEGSF
RCECMAGMAVGLDGRVCVDTHMRSSCYGGYKRGQCVRPLFGAVTKSECCCASTEYAYGEP
CQPCPPQNSAEFLALCPNSIGTTGDGRDINECALDPDICQNGVCENMLRTYKCTCNEGYE
VDLSGKSCIDIDECLINRLLCDNGLCRNTPGSFSCQCPKGYAFNPKTDVCEVSPDVNECQ
SNPCINGECKNSQGSFVCLCSMGSSLDSSGLECIETIKSVCWLKIINNRCEVNINGATLK
SHCCATLGEAWNSPCSKCEKDAICSKGFARVRGNLCEDVDECQVFPGVCINGKCINTPGS
FFCQCPPGMTVDVSGRMCIDLRTEHCYLTHEDERCGAPISGRHRVDACCCSVGVAWGPEC
DECPERGSPEYEQLCPRGPGFSHRGDFLNGRPFLKDINECRMINTLCSNGRCRNTIGSFR
CRCDNGYALDADERNCTDIDECRISVDICGPGRCVNTPGDFECECFEGYESGFMMMKNCM
DIDECERNPLLCRGGDCVNTEGSFQCVCPMGHEIAPDGSACLDINECELSDRLCRNGQCI
NMIGRYQCACDTGYKSTESRVECVDIDECTIENGGCETFCTNSEGSYECSCHSGYALLPD
LRSCTASDIDECVESPDICDGGQCTNTPGMYQCLCFDGFMSSDDMKTCLDVDECELNSNI
CLSGNCENTKGSFICHCDMGYSVRKGTTGCTDINECEIGAHNCHRHATCTNTAGSFKCDC
APLWIGDGITCADLDECSNGTHKCNNNAECQNTMGSYRCTCKEGFSGDGFYCSDSDECAE
NSDLCDNGNCLNLPGGYRCECDMGFIPTVDGKACEADIDECTFSDICVNGRCHNIPGLFR
CECNPGYELDRTGGNCTDVNECADPTFCINGICVNNAGSYLCQCPVDFQLNPTGVGCVDT
RSGSCFLDVRSRGDSSESLDCSNEIGVGVAKASCCCSQGKGWGSPCEPCPSGNSTEYKTL
CPGGEGFRPNPITVILEADINECQELPGLCQGGKCINTFGSFQCECPRGFTLNTDTRVCE
DVNECEQPGICGPGKCYNTIGNYTCICPVDYMQVNGGNNCMDMRKSYCYRNFYSDNNTCD
GELTFNMTKKMCCCSYNIGRAWNKPCEQCPLPSTEEFTFLCGSERPGYYIDIITGRVIDI
DECREIPGVCENGLCINMIGSFRCECPIGFIYNDKLLICEDIDECQNGPVCQQNAACLNL
PGSFRCDCKPGYRFTSIGQCLDRNECMENPGICNPGQCIDTLGSYRCICPNGFKVTRDQS
MCVDVDECEKQPCGNGTCKNTVGSYNCLCYPGFQNSHNSDCIDVDECAVQRGLCRNGQCV
NTIGSFLCECNEGYELTQDGRLCADINECAINPSTCGPGTCLNLDGSYRCICPPGYYLHE
ETCKDIDECSQLPEICTFGTCSNTVGSFTCLCFPGYQISASGRTCIDFRVNYCYTKFENG
RCQAPKPQNTTKEVCCCTGMPGQGWGDPCEICPSKGEEAYPHLCRKEGYQQGRDEKPKAD
VDECLNDPCINGQCINTDGSFRCECPMGYQLDISGVTCEDTNECSTGNPCGNGTCTNAIG
GFECACDDGFEPGSMMTCEDINECAQNPLLCAFRCVNVVGSYECKCPTGYVLREDRRMCK
DQNECEDGIDDCASRGMSCKNLIGTYMCICSPGYTRQPSGDGCMDLNECAAKPGICKNGR
CENTVGSYRCKCDQGFVANPTQTECIDNREGFCFTEVLTTLCQMSSSNRNMVTKAECCCD
GGRGWGTSCELCPLPGTTQYKKMCPLGPGFTTDGRDIDECRVMGNLCKNGQCINTLGSYS
CTCKPGYTTDITGAVCVDVDECIQAPKPCNFICKNTEGGYLCSCPRGYILQEDGKSCKDL
DECSSKQHNCQFLCVNTIGGFTCKCPPGFTQHHSACIDNNECATDPSLCGSNGVCQNTPG
SFSCDCQRGFSLDPSAQTCEDMDECDGNHRCQHGCQNLVGGYRCSCPGYLQHYQWNQCVD
ENECLNAQICGGASCHNTLGSFRCLCPTGFNYEQGGGGCADINECSTSQNPCKFGCSNTD
GGYLCGCPPGYYRAGQGHCVTGLGFGSSSGGPGQEGEGDDNSLSPEACYECKINGYPKKG
RQRRSANSTHEEDVQLTEEVSLASVDIEDTLQFHLNLSDLSNRDHILEFTPALSTLSDHV
RYSIDLGNDEGYFKINQRDGVSYLHLSRKKSLPPGAYLLQISSMPLYRKKELSEMEDQHD
KDYLTGQLGEILRMRVQIILH
Download sequence
Identical sequences H3C3M8
ENSTNIP00000002847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]