SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002849 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002849
Domain Number 1 Region: 215-442
Classification Level Classification E-value
Superfamily vWA-like 1.27e-33
Family Integrin A (or I) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002849   Gene: ENSTNIG00000014688   Transcript: ENSTNIT00000000642
Sequence length 901
Comment pep:known_by_projection chromosome:TETRAODON8:11:6357583:6366014:-1 gene:ENSTNIG00000014688 transcript:ENSTNIT00000000642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRASAPLSLFGLLLAVVTALPVRENWDIYSYHINSTVTSRYAITVITSRVANRMEESKE
IEFHVRIPKNAFITKFKMVIDGQEYDGIVKEKEKAQQQYSQAVSRGQSAGIVSSVGRTLE
EFKTSVTVAAHKKVTFELTYEELLKRRLGKYELQIHARPMQPVKDFKVDVYINENAGINS
FMVKGGLSTKELANAVTTTQAEKEAWVHFYPTVDQQKSCDSCDDKGMNGDLIVVYDVNRN
TSLGDIQRSPGYFVHHFAPSNLQRIPKNVVFIIDQSGSMHGRKIEQTRTALIHILNDLAE
DDFFGLLTFDSNIFQWKRELVQATKANLESAKTFARNIRANGATNINAAVLKGSSMLNAH
PREGSASILILLTDGDPTTGETNPEAIQSNVRNAIAEKFPLYCLGFGFDVNFEFLEKMSL
QNNGVARRIYEDSDADLQLKQQGFYEEVATPLLTNVMMIYVGGTNLTKTSFSHHYKGSEI
VVAGVISDNDVETFAPQVVAISKSRRLVFDDKNATTETSVMASDSQMQRIWAHLTVKQLL
DKELHLSGSEKEDAKNEALKLSLRYGFVTPLTSMVVTKPQGESTDVLDKPKEGNTWPRGG
VAGPPFHGFGSAAPGKIWTMFQWHTKGNSHISGNAGPPGLPGSRYIGAAESAVCQKGCQC
TQHKCVSFQPPLFMILLLLPTMSMTTECLPRLSQQLPQPLQVNFMRKPADGSLPLCFDVP
VGRLKLLHHPNMAELTVNGELSSETPGFSKIVIHLKEDQHVEVDSSKIVVRDKQSVSHYS
GDEPHTVGSITVIRRAKEIDITVGDTRMVILIHLHQGKEFLWPVLRQRPSDSGVTGILGL
QPVVYEEQFPEKLKIDSREIEATRRTAVDYSEAVPRQQDCWRTSAEDALQAPLHHFTISE
L
Download sequence
Identical sequences H3C3N0
ENSTNIP00000002849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]