SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002888 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002888
Domain Number 1 Region: 443-568
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-31
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 236-342
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-29
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 344-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-22
Family Cadherin 0.004
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-22
Family Cadherin 0.004
Further Details:      
 
Domain Number 5 Region: 559-668
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000131
Family Cadherin 0.0031
Further Details:      
 
Domain Number 6 Region: 30-101
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000371
Family Cadherin 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002888
Domain Number - Region: 770-801
Classification Level Classification E-value
Superfamily Cadherin-like 0.0114
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002888   Gene: ENSTNIG00000010770   Transcript: ENSTNIT00000000653
Sequence length 956
Comment pep:known_by_projection chromosome:TETRAODON8:7:7291339:7320221:1 gene:ENSTNIG00000010770 transcript:ENSTNIT00000000653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLKTGLCGKWQIMYCSVLCACLLDAVWGQIRYSIPEELEHGAFVGNIAEDLGLDADKLS
ARRFRIVSGGKRQYVEMNLENGVLFVNERIDREELCEQSLSCAFHLQVVIENPLELYRVE
LEILDVNDNSPSFPWTEFNLDISESAAPGSRFPLESAQDSDVGSNSLRTYLLSVNEHFLL
DIQTRSDGSKFAELVLQTPLDREQQSAHQMVLTAVDGGAPERSGTAQIDITVLDANDNAP
VFDQSFYRVRLAENAPKGTVVIKLNASDLDEGPNADITYSFSGHAPLKVRQLFSVDPRTG
EIKVKGVIDYEKARMHEIYVQAKDKGPSAVAVHCKVLVNVLDKNDNIPDVILTSVSTPVQ
EDAPPGTVIAVISVTDKDSGENGNVDCEISHHVPFQLHSSFKNYYTLVTSDFLDRESVAE
YNITLTARDMGSPPLFTRKTILVQVADVNDNAPRFKQPSYTVYLTENNAPGASICAVTAL
DPDSGQNAYISYSVHEGDIQGMPVSTYVSINSDNGNIYALRSFDHEQLKNFQITVQAQDA
GLPPLSNNVSIVIFVLDQNDNPPVIVSPVSRNGTAPDQAVPRSADAGHLVTKVRAVDADA
GQNSRLLYQMIQATDPTLFSVALYTGEVRTIRQLVEKDPTRHRLVILVKDNGQPALSATV
SISLSVVDSLPESKPETTELPLEYDVFTDLNLYLVIGLGAVSFLLLITILVIIVLKCCKG
HRFDSKLGAAQSELMPSHPSASFIISYTPERVRQMFSMDTNTGEIRIVLSSLSSPVREDA
RADTVVALISVTDRDSGTNKQQPKAPNADWRYSASLRAAGVQSSVHMEEASVMQGAQGML
VQNWPTVSSAAGVDGEGGGELSPPVGAGVNSNSWNFRYGAAQAYYPPQPLKPGEIPPEAF
IIPGSPAIISIRHDAGPVDDKGEFISFGKKDEAVNLLTSQYQSKTHKKQKSKAKTE
Download sequence
Identical sequences H3C3R9
ENSTNIP00000002888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]