SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002892 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002892
Domain Number 1 Region: 254-390
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-27
Family Cadherin 0.00017
Further Details:      
 
Domain Number 2 Region: 479-605
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-23
Family Cadherin 0.00041
Further Details:      
 
Domain Number 3 Region: 372-484
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-21
Family Cadherin 0.0000764
Further Details:      
 
Domain Number 4 Region: 164-258
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000038
Family Cadherin 0.0000959
Further Details:      
 
Domain Number 5 Region: 32-177
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000497
Family Cadherin 0.0045
Further Details:      
 
Domain Number 6 Region: 592-690
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000251
Family Cadherin 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002892   Gene: ENSTNIG00000005512   Transcript: ENSTNIT00000003178
Sequence length 735
Comment pep:novel chromosome:TETRAODON8:Un_random:38118713:38129654:1 gene:ENSTNIG00000005512 transcript:ENSTNIT00000003178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGRFWSPGLCMFVFILLILLGVSTLVTPEEQTCVPGFKQSTFILKVTSKHLRQQVSLGKV
NFEDCTDRTRFSFSSSDGRVRAQADGALTVKRPITLHEGHLDFLIHIWDSRGRKHTLPVR
LLHQERQRDEDNAEAGMEAQVPVVYFHKSGEGLKRRKRDMVIPPLSVAENYRGPYPHKIS
QIRSNQDKLWRIHYSISGPGADQPPVNLFTMDQVSGTLFVTQQLDREKQANYTLKAHAVA
EGSGTAEDPMDIIVNVIDQNDNKPGFVKDTFLGKVPEASPTNFEVIQVEATDLDEPNSDN
SDIRYKILSQEPKLPSDNLFAINEVTGAIRVNAGGLDREKYPEYTLEVQAADMKGIGLTG
VAKVILTVTDSNDNAPAFTQASYETSVAENKADSQILRMQVTDWDEPHSAAWNAKFTIVS
GDPGGFFSVKTGTNKQEGILSTAKGLDFEKNSKHTLLIAVENEVPFAVALPTATATVVVT
VQDVNEAPIFDPPEKQVSKGEDLPVGTDVVQYTASDPDTARKQKVMYRILNDPAGWLNVD
KETGVIKVKTPMDRESLFVKDNKYTALIGAYDDDEVPATGTGTLMVLLEDVNDNAPVIEE
RAFRVCRNKPAPQLLSVTDKDGPGNGAPFSVSLQDPSRSNWTARMNDSKTGIILQLTKAL
ESGQYTVVLRVADNRGRDQDNTVQATVCECTGEDNQCQERVAAGTNLFFINIIRGGILLL
LTLVMLILLFARWMK
Download sequence
Identical sequences H3C3S3
ENSTNIP00000002892 99883.ENSTNIP00000002892 ENSTNIP00000002892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]