SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002893 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002893
Domain Number 1 Region: 479-704
Classification Level Classification E-value
Superfamily vWA-like 3.34e-61
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 30-218
Classification Level Classification E-value
Superfamily vWA-like 3.53e-55
Family Integrin A (or I) domain 0.00027
Further Details:      
 
Domain Number 3 Region: 395-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000549
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 4 Region: 218-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000678
Family EGF-type module 0.027
Further Details:      
 
Domain Number 5 Region: 252-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 713-758
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000000562
Family Chicken cartilage matrix protein 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002893   Gene: ENSTNIG00000005220   Transcript: ENSTNIT00000000400
Sequence length 759
Comment pep:known_by_projection chromosome:TETRAODON8:11:11916341:11921067:-1 gene:ENSTNIG00000005220 transcript:ENSTNIT00000000400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTKMRVHGFILMTVVVLATARPRAGPEQKCRSGPVDLLFLIDSSRSVRPHEFETMRRFMI
DILNTLDIGLNSTRVGVVQYSSQVRSEFSLRSHASLDSMVKAIQEMVPLAQGTMTGLAIR
YTMNVAFTAAEGDRPKVPNVVVIVTDGRPQDRVAEVAAEARERGMEIYAVGVARADMTSL
RAMASPPFEDHVFLVESFDLIHQFGLQFQDKLCGADLCVESDHGCEQVCESSPGSFRCLC
LPGFTLNHDGKTCSAIDLCSEGKHDCQQICVSSPGSFTCGCGPGFRLNQDQKTCTNITSP
SNRQQPLATPTSAPLLKLAVFLAMTESELRNRSLCASRRLTEACNANVATGVYLHTSKPR
ANSPGLRTGRRSLSVVTWSEEELRCTFSAPPSVIDYCSHGNHSCDHECVSVLSGYHCQCN
HGYRLLDNGWTCRAIDLCSEGKHDCQQICVSSPGSFTCGCGPGFRLNQDQKTCTDVDLCN
SLDHGCEHQCVNTPGSFYCACADGRSLQEDGKSCGTCKSANIDLVLLIDGSKSVRPQNFE
LVKKFVNQVVDSLDVSPQGTRVGLVQYSSRVRTEFPLSMYHSAQEIKAAVMKVEYMEKGT
MTGLALKHMLENSFSEAEGARPARRHVPRIGLVFTDGRSQDDISEHARKAKEAGITMYAV
GVGKAVEEELREIASDPVEKHSYYSADFTTISTIAENLKLNVCPEESQGELEVKDPCACD
RLVEFQQATMSSLEQLGALTRGPLAGMTSRLEQLEKQLL
Download sequence
Identical sequences H3C3S4
99883.ENSTNIP00000002893 ENSTNIP00000002893 ENSTNIP00000000307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]