SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002895 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002895
Domain Number 1 Region: 2-544
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.69e-172
Family Motor proteins 0.0000000231
Further Details:      
 
Domain Number 2 Region: 1705-1821
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-24
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 3 Region: 999-1102
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.95e-20
Family First domain of FERM 0.04
Further Details:      
 
Domain Number 4 Region: 1094-1187
Classification Level Classification E-value
Superfamily Second domain of FERM 9.81e-16
Family Second domain of FERM 0.0052
Further Details:      
 
Domain Number 5 Region: 1604-1712
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000827
Family Ras-binding domain, RBD 0.093
Further Details:      
 
Domain Number 6 Region: 1822-1912
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000113
Family Third domain of FERM 0.014
Further Details:      
 
Domain Number 7 Region: 1315-1379
Classification Level Classification E-value
Superfamily SH3-domain 0.000000195
Family SH3-domain 0.004
Further Details:      
 
Domain Number 8 Region: 541-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000814
Family Motor proteins 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002895   Gene: ENSTNIG00000004772   Transcript: ENSTNIT00000000849
Sequence length 1927
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:71829929:71845615:1 gene:ENSTNIG00000004772 transcript:ENSTNIT00000000849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLQACDERNYHIFYCMLNGMTADEKKLGLSRPGDYTYLTMGKCTLCDGRDDTKEYSNIR
SAMKVLMFTDKENWEISKLLAAILHMGNLRYDARTYDNLDACEVVRSPHLTTSATLLEVD
CKDLMNCLTSRTLITRGETVSTPLSMDQALDVRDAFVKGIYGVVKPMSSQPKYVRRSIGL
LDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLEHINWQHIEFTDNQDA
LDMIAIKPMNIISLIDEESRFPKGTDTTMLNKLNFQHKLNSNYIPPKNDHETQFGIQHFA
GVVYYETRGFLEKNRDTLYGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFK
RSLELLMRTLGVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIR
YTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRISEVVLGRDDDWQMGKTKIFLKDHHDML
LEIERDKAITDKVILIQKVVRGFKDRSTFLKMRKSATLIQKTWRGYQCRKNYGAMRVGFS
RLQALVRSRKLCASYHVARQRITYFQGRCRGFLVRRAFRRRLQAVVIIQAYTRGMIARRL
YKRLRGEYHRRLEAEKMRLAEEVKLRNQMSAKRAKAEAERNHQERLAQLAKEDAEREKNE
KEEARKKKEMVEQMEKARMEPVNDSDMVDKMFGFLGTTSSFPGQEGQAPAGFEDLERSHR
ELEEEDLDEALPLPEDDEEEDLSEYKFAKFAATYFQGTTSYTYVRRPLKQPLLFHDDEGN
QLAALAVWITILRFMGDLPEPKYHTAITDGSEKIPVMTKIYETLGKKTYKRELQALQGEG
EVPQSDSHKKNSVRHKLVSLTLKKKSKITEEVTKRLTDGEYSLHGNSMLEDRPTSNLEKL
HFIIGNGILRPALRRDEIYCQICKQLTQNPSKSSHARGWILISLCVGCFAPSDKFVKYLR
NFIANGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLL
ADSATTAKELCTALSEKVNLQDRFGFSLYIALFDKVSSLGSGNDHVMDAVSQCEQYAKEQ
GAQERNAPWRLFFRKEIFTPWHCPSDDHIATNLIYQQIIRGVKFGEYRCDRDELAELASQ
QYYIDYGSEVLLERLLSLIPSYIPDREISTSRTVEKWAHFIMAAHKKGIYAQKRFDPQKV
KEEVVDFARHKWPLLFSRFYEAFKFSGPTLPKNDLIIAVNWTGVYFVDEQEQVLLEMSFP
EITAVSSSRGSKLQSQSFTLATIKGDEYTFTSNNAEDIRDLVVSFLEGLRKRSKFVVALQ
DNPNPTGEESTFLSFLKGDLIVLDQDTGEQVLNSGWAHGVNERSKLRGDFPADCVYVLPT
MIYPQQELVALVTMTPAQRQESVRVSQLVLPESVDRVKPYTLEEFSYDYFRPPPKHTLSR
VMVTKNRGKDKLWSCTREPLKQPLLKKVVNHEDLSQEACLSFIDILEKKYMGDYPSKRTR
SVNELTDQIFEAALKAEPLKDEIYSQIIKQLTDNHVKYSEEKGWELLWLCTGLFPPSNVL
LPHIQRFLQSKKHHPLSGDCMQRLHKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPD
DTDEAFEVESSTRAKDFCQNISSRLLLKSAEGFSLFVKISDKVISVPEGDFFFDFVRHLT
DWIKKSRPATKDGIIPCLTYQVFFMKKLWTSTVPGKDSFADSIFHYYQELPKYLRGYHKC
SREEVFQLAALIYRVKFEDDKSHFPTIPKMLRELVPQDLIRQMSPDDWKRSVVAYFNKHA
GKSREEAKLMFLKIIYKWPTFGSAFFEVKQTTEPNFPEILLIAINKHVGMGRYPKTKDIL
TTHPFTKVSNWSSGNTYFHITIGNLVRGSKLLCEPLLGYKMDDLLTSYISQMLTTMNKQR
SGRSQTK
Download sequence
Identical sequences H3C3S6
ENSTNIP00000002895 ENSTNIP00000002895 99883.ENSTNIP00000002895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]