SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002909 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002909
Domain Number 1 Region: 2-363
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.15e-93
Family Regulator of chromosome condensation RCC1 0.0013
Further Details:      
 
Domain Number 2 Region: 660-994
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.32e-67
Family Hect, E3 ligase catalytic domain 0.00000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002909   Gene: ENSTNIG00000010295   Transcript: ENSTNIT00000000742
Sequence length 1006
Comment pep:known_by_projection chromosome:TETRAODON8:10:10010410:10018967:1 gene:ENSTNIG00000010295 transcript:ENSTNIT00000000742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLYCWGDSSSGQFGPRTATRPVSWTVPRTVIDISCGDRHILFLTEDGCVLSCGNNSDGQ
LGRKKKHKNKAPGCVEGLGHVVQISCGCNHSLAVDASGHVFSWGAAEDGQLGLNPNPLSG
RPSMVTIPLRVPVVQVACGKSHSVALTTGGDVLSWGSNSYGQLGLGTEVPSQETPALVAG
LVGVPVSQISAGATHTMFLTLAGLVYCCGANQSGQLGLNRVDEKGRFDVCMVPRLRPLGV
CFISCGEAHTAALTMNGEVFTFGEGCHGQLGHGSTADELRPRLVESVGRHASQISCGSYH
TLVLGSSGHIWAFGSGNKGQIGTGHQDDVLTPTMVELPWTTDDAAAAPTDLKISAGWNTN
FAYVSTVQVTKSKLNPKRGQVTGRLNEARLQRWLRTTTPNTETENSNSEIKSVFFTSSSL
VSSFTKAGGPSLEAGALTVDLEAVCRAFDQLLAIPWIKKLFKDNFSFLTDTLMLSRTALN
SPEIILILLACPLFQEETHVCHVWKIALVISDLKEKCLKALKDCWSSLMPPMLLKHILVF
KNTLGFMLKNSLHVPVGKHVLEILKLLFQANKAGKSYKLPLSTFPVEEINCINVHPALCL
KPWSLSVEEYKPALFRQYPFLLPLEFKVELFKASAFIEKLQEAEYLNYQMMMVTRASTDS
PPAPFFQLTLRRNHLVEDSFRQLAAADHCAFRKKLLVIFTDNRKVTNVNISDFFLHVFGH
LIDPKSGMFMYNEDETLAWFPPKPKKKARIYFLFGVLCGLAFFHQNMVHLPFPLVLFKKL
LRVKPSLDDLREFDPVRAESLRYLLEDCSPEEVESLDATFTETWGGETVELDPSESGKPV
TASNRQQFVAAFVNHAFNASVESVFEEFKRVYKEFHIIIECLIIHTVVRFEQNTVYEEPY
DANHPNIVTFWEAFDRLSAEEKKHFLWFLTGSERVPLGGMKSIKMAVATLANATELALPE
SLTCYHLLMLPVYDSDSPDSISLMQSRLLQAIYNKSGFRTTFFTKC
Download sequence
Identical sequences H3C3U0
ENSTNIP00000002909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]