SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002932 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002932
Domain Number 1 Region: 4-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.79e-69
Family BAR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 403-520
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.54e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00018
Further Details:      
 
Domain Number 3 Region: 238-360
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-25
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 4 Region: 615-735
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-24
Family Ankyrin repeat 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002932   Gene: ENSTNIG00000010153   Transcript: ENSTNIT00000003087
Sequence length 776
Comment pep:known_by_projection chromosome:TETRAODON8:20:686845:694050:-1 gene:ENSTNIG00000010153 transcript:ENSTNIT00000003087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRAEIEEVQNDVSELETRLEKLVKQCQAMVEASRAYCQTSKSFV
NGLRELGHHCSGDAMMEGCLEKFSKTLSAILEGQGELIETMQSVKTKLQTFVKEDVRRFK
DVRKEFERSSECLEGAQARNAQAPRGKQHEVEEASNALLNARRGFRSEALDYVLQINVIE
AKKKTDILMAMLSLMEAQSHFFQHGHQSLSELDQYRQKLNEEHTQFVLNSAREKRDMEQR
HAAVKKKDISYDDSIMDFNADAANGIAMEGYLYKRASNAFKTWSRRWFSIQKNQLVYQKK
FKEQPTVVVEDLRLCTVKNSTENERRFCFEVVSPSKCCLLQADSERQQQAWISAVQSSIA
SAFQEHREDTHSPRQRCSSVSAGPLGGVGGGAGGAHQEGQGPKALEEVQAIPGNKQCCDC
GEPGPDWASINLGITLCIECSGIHRRSLGVHFSKVRSLILDSWEPELIKLMCELGNTVIN
RIYEARIEEMTIKKPHPSSSREEKESWIRSKYVEKKFIQKLPVTGRNVLLLRRSSAVKTR
TMTAPRPPLKPKPNRATLPRLTGRAAEWGGWRQVETRWEICASTTFLSLCNSSKLLLTEV
EEPEEDLSGLHPGALLYRSAALQNFPIMADALAHGADANWVNVAEESSTPLIQAVSANAL
AACEFLLQNGAHVNQADSNGRGPLHHATILGHTGLVCLFLKRGADYNAKDKNQKDPISIA
VDNANADIVTLLRIAKMNKEMREMDGAFGQPGDETYQDIFRDFSHMASNNPEKLKR
Download sequence
Identical sequences H3C3W3
ENSTNIP00000002932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]