SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002949 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002949
Domain Number 1 Region: 25-115
Classification Level Classification E-value
Superfamily BRCT domain 1.37e-21
Family DNA-repair protein XRCC1 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002949   Gene: ENSTNIG00000001202   Transcript: ENSTNIT00000000062
Sequence length 117
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:68455948:68456751:-1 gene:ENSTNIG00000001202 transcript:ENSTNIT00000000062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDPYGGSTDENTDAEAEQDHPIPDLPDFLNGKHFFLYGKFPNNDRRLLLRYIVAFNGVIE
DYMTEKVQFVVTSEGWHSSFEDALVDNSNLCFVKPAWIYAINERQKMLPYQPYTVVP
Download sequence
Identical sequences H3C3Y0
99883.ENSTNIP00000002949 ENSTNIP00000002949 ENSTNIP00000002949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]