SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002977 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002977
Domain Number 1 Region: 945-1232
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.34e-84
Family Complement components 0.0000364
Further Details:      
 
Domain Number 2 Region: 773-893
Classification Level Classification E-value
Superfamily E set domains 1.68e-34
Family SVA-like 0.012
Further Details:      
 
Domain Number 3 Region: 1293-1426
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 9.16e-33
Family Alpha-macroglobulin receptor domain 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002977
Domain Number - Region: 365-427
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0251
Family Invasin/intimin cell-adhesion fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002977   Gene: ENSTNIG00000014380   Transcript: ENSTNIT00000000381
Sequence length 1434
Comment pep:known_by_projection chromosome:TETRAODON8:16:8290659:8298848:-1 gene:ENSTNIG00000014380 transcript:ENSTNIT00000000381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALFLCLNWIFTDGAAAGPQFMVAIPAVMEAGAESRLCISLLQPNETLAVTAKLVFEDK
ATVIFERSSDKEFHQCAVFQAPEVETPEVHALLVTVRGDQFHSVESRKVMFKSYKPETFV
QTDKPIYLPGQTVHFRVVTLDSMFRPANGLFHTIKILDSHQNRIGQWLNATTDGDILQLS
FPLSAEAREGYYSISVWMEQSQVTRRFKVEKYVLPKFEVTIEMADQVSVGQEEIDVDVCA
KYTYGQPVPATVTVEMCRKLRSSSDTLIQVPCFEEEKKVPKYPKWMSEYTDKRGCAKFTP
SMSTFTKIDSKVLQRTLFLTAKVQEEGTGTLFSKQKRVELSFIIGKLFFVDTPNSYNEGS
MLEGKIKVVHYNDTPIADKQIQLLNDKSWQGHVLQNLTTDADGIATFSLNTTLFNGEEIQ
LRVRGLRWATKPKFESAHHRASLYQPPSPHSKSVSSLTVSNTETPLLCEGDETLSIDYAF
VGETAGTVNLMYLIVSRGKIVTQGVQTVQILTDPTTEGSISFTLKMSPEFSPALQVVAYT
ILPSEHVIAHKADLAVTKCFLNKVSVEFSPTSAVPGDDTTLKVKALPDSLCGVSAIDQSV
LVKEPGNTLTPEQIFNMLPVRKVSSIPYEVEDAVPCLRVRQKRYIGRRRRPDDVNDAYSV
FEGIGLKVATNLLFRMPSSETSDSRRGFSSVYRESVPYIMAMKQKGTGAAPGGGVIETIR
TFFPETWVWKLVKVGESGETDVALTVPDTITTWETEAFCVSPQGFGLAPRKEITVFQPFF
LELSLPYSIVRGEQFELKATVFNYQTSCMMVSVKTAKSEDYTLTPLSANEYTSCLCGNER
KTLSWTMLPSVIGVVSVTVTAEAVASHASCDNEIVSVPERGRTDTVTRSLIVKAEGTEMT
KIHNWLLCPKEEPLKEEVELDLPANVIDGSARALVSVLGDILGRALKNLDGLLRMPYGCG
EQNMALLAPNIYILQYLKSTGQLTDTILKKATHFLTSGYQRQLNYKHSNGAFSTFGTGSG
NTWLTAFVVRSFAKAKTFVYIDEAKMDSKNWLLLRQNPGGCFQQYGKLFNNRMKGGVSDE
VTLSAYTMAAFLEMGMSPTDPAIHRSMLCLKDSVSNLNNTYTTALLAYVFSLAGDMKTRD
FLLQHLDTVASGQGSLLYWSQSAEDQSSSLSVEISSYVLLAKLSSSPTAEDLGYASRIVR
WLTGQQNYYGGFSSTQDTVVALQALALYSTLVFSPAGSSTVTVQAPSGQLVFDVNQDNKL
LYQEKTLQDLKGTISLEAAGSMCASIQISLHYNIPTPTDTNIFSISVKPECSSEKNRVTL
QLMSQYSGKDITTNMVILDVKMLSGFVPDPESVKSLRGALFVDRVEEKEERVLVYIGELL
KDIPIIHTLSLTQVVPVENLKPALVRVYDYYQPSDQAETEYIFPCAAGKYKNNA
Download sequence
Identical sequences H3C408
ENSTNIP00000002977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]