SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003039 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003039
Domain Number 1 Region: 84-327
Classification Level Classification E-value
Superfamily vWA-like 7.6e-69
Family Integrin A (or I) domain 0.00000141
Further Details:      
 
Domain Number 2 Region: 1101-1284
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-39
Family Fibronectin type III 0.0000333
Further Details:      
 
Domain Number 3 Region: 1620-1709
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-19
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 4 Region: 1491-1604
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-18
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 5 Region: 958-1077
Classification Level Classification E-value
Superfamily CalX-like 9.68e-17
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 6 Region: 583-663
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000144
Family Integrin beta tail domain 0.0035
Further Details:      
 
Domain Number 7 Region: 498-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003039
Domain Number - Region: 4-36
Classification Level Classification E-value
Superfamily Plexin repeat 0.000173
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number - Region: 540-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family Integrin beta EGF-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003039   Gene: ENSTNIG00000011514   Transcript: ENSTNIT00000003009
Sequence length 1802
Comment pep:known_by_projection chromosome:TETRAODON8:2:4151449:4163913:-1 gene:ENSTNIG00000011514 transcript:ENSTNIT00000003009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLAKGCAYCTEETFNGPRCDLQENILAHGCGAAAIITAQSTMEIVKKEQINMKLQQSQVS
PQQIRMNFLPGEEKMVDVEVFAPTKGPLDLYILMDFSNSMADDLDNLKRMGNELATLVEQ
LSDDYTIGFGKFVDKVIEPQTDMRPEKLKKPWPDSDPPFSFQNVIKLTNDLNFFTAKLND
ETISGNLDAPEGGFDAILQAAVCGEKIGWRSDSTHLLVFSTESAFHYETDGVNVLSGILK
RNDEQCHLDSAGKYTEDIHQDYPSIPTLVRLLGKHNIIPIFAVTNHSYTYYQKLKEYFPI
AEVGLLQEDSSNILQVMETAFKSIRSKMSIRAENRPKAFEAQFLSAGGKLSEYGDFDFTP
GAIGKFKMRLKAQRTIDDTPVCDAAQAEKYGTMRVKPTTFTKAVNVNADVLCPACDCEKI
RVENAPRCHGNGRLVCGKCECYSGWLSTFCNCSASAALVTGQCIGPDMKEPCSGRGDCME
CGTCVCYNPEQFEGPFCEYDKTQCQRYGGFLCNDRGSCVMGKCACTEGWEGNACECPKSK
QTCLDSKGGICNGRGKCVCGLCECPNSGIELTSTCEPNFAQLGACEATRSCVQCQAWKTG
EKKDKKDCDTCPFTVVMVDELKESDKVLDSCSFRDEDDDCTYHYTVENPKDKDLEVQVLK
KKATPLDCPPASLLWLLPLLLFLLLLLALFLLCCWKYCAGCKPCCQGCLALLPCCRRGRT
VGWKEDEYLFRQSLLTSDHLDTPMVRSGPPKGTDVVRWRVTDNVHRGLNHPQAVAKPNPK
EMIPFPLSVRLDKLFFDNLARPESKEAEQLRSEVADNLNELYKQIPGAQKVQKTSFRMQR
NAGKRQDYTIADTVLSAPRSSFPDIVKLTEKNVQSGRMNNLKVVPGYYTIETDRATEAMG
AIEFQEGVESLDVHVPLFVKEEDDDKKKLQLEAVDVPLGIAKIAKRFVNITIIKDRANSI
FSFPQPAYTYSRRDGVINIPVSREIIEDGRTQVTYRTRDLTAKDKLDYVTVEGDLTYLPG
ETQKNVSVRLLELGEKDGLLEDKQPKQFVMDLSNPLVGAKLGRYQRTTITIADQPGPEIS
QKQQKGYVSPKATGPGGLLYAPSNPQAKATGPRSIQLNWEPPPGNPMGYKVKYWIYGDPE
KDAPVLDVKSPRADLTNLYPYCDYEMRVCAYNENGDGYDTDIVTCQTPEDAPGKPGRLAF
NVISPTVTQLSWAEPAETNGNITAYEVIYTPIDDELKPVGAPKKVQIDNAKKRMLLIENL
QNAQTYQYKVRAKNSVGWGPFRDASINLASQPNRPLSIPIIPDIPIVDAEAGDEYDSYLM
YSNEVLRSPTSSKSPSVSGDVIIFPTLRGWKYVKLVGSSLDLRKVSWNKQVDFISSRLST
DSSSDEAPRLGLTHTPLPGEDRAIGAADRREASMSSKTTSASLLPRLIENLLNHAEPPPA
NTKWEQSLLSPGGSGPRNLSASSSPMSTLSSNYRAAGGSYNTEVTTTYLSGPGFTSYPSD
ARLSPGVPDTPSRLVFSALGPTALKVSWQEPHCERDIMGYCVIYQLLSGGEVKRINVTNP
AENSVIIQDLLPNQSYLFKVKAQSQEGWGPEREGVITIESAVDPRSPLCPMPGSPFTLST
PSAPGPLIFTALSPESLQLSWEKPRKPNGEIRGYVVTCEQLHGGGDVRTFQVHGNSAETS
LTVPDLVENVPYKFKVQARTTEGFGPEREGIITIESQDGSALSQYNSQSMGRRDVFHMPT
EVNTRTNVSHTVVNDPFHSEGMMVTTQRTETSGMVTHQITKEVVQRSVVGGTTVTKKMFY
ET
Download sequence
Identical sequences H3C470
ENSTNIP00000003039 99883.ENSTNIP00000003039 ENSTNIP00000003039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]