SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003060 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003060
Domain Number 1 Region: 101-304
Classification Level Classification E-value
Superfamily vWA-like 4.03e-54
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 305-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000441
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 3 Region: 353-379
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000667
Family Chicken cartilage matrix protein 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003060   Gene: ENSTNIG00000003118   Transcript: ENSTNIT00000000599
Sequence length 398
Comment pep:known_by_projection chromosome:TETRAODON8:14:4255838:4258916:1 gene:ENSTNIG00000003118 transcript:ENSTNIT00000000599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HYRYQPPGIPPPVVYRPFLLSPPKPKASCPKNLVPTFSSAPVAPLPTIPSPPNPTVQLTT
PPAPLATITPEVLPVETSAPATLSVSTFTTTVSAVETGPGCLNVPLEPSTTKTDSSCLSR
PLDLVFIIDSSRSVRPSEFEKVKIFLADMVDTLDVGADATRVAVVNYASTVKTEFLLKDH
FNKPNLKKAISRIEPLATGTMTGLAIKTAVSEAFTEQSGARPRPRNIAKVAIIVTDGRPQ
DQVEEVSAAARASGVEIYAVGVDRADMRSLQLMASVPLEDHVFYVETYGVIEKLTSKFRE
TLCGVDPCAVGHDCEHICVNSNASYYCKCRNGYILNADKKTCSLKLKEVKVEVVEDPCKC
EARLSFQKQTQATIQQLTARNILPVVSDKNSSSDHRRV
Download sequence
Identical sequences H3C491
ENSTNIP00000003060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]