SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003075 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003075
Domain Number 1 Region: 900-1022
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-26
Family Ankyrin repeat 0.000000254
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-24
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 3 Region: 1028-1089
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-16
Family SH3-domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003075
Domain Number - Region: 810-815
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003075   Gene: ENSTNIG00000008659   Transcript: ENSTNIT00000000157
Sequence length 1098
Comment pep:known_by_projection chromosome:TETRAODON8:17:5707632:5718919:-1 gene:ENSTNIG00000008659 transcript:ENSTNIT00000000157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLTVYLSNNDQHFTEVPITPETLCRDVVELCKEPGEADCHLSEMWRGSERAVGEGERMF
DLLQRWGQHRPEVRFFLRHNRAPSRELAAGSRASEPKRNGLKGPPDRRMENGVAPPRMDM
TLAELQEMAARQQQQIEAQQQLLASKEQRLRYLKQQEQRQQQQASEQEKLQRLRENIDNQ
ETRLKKVRALKGQVEQKRLSNGKLVEEIEQMNNLFQQKQRELVMAATKVEELNRQLELLK
TSKMEHFNDNQSSVAELDRLYKELQLRNKLNQDQNSKLQQQRENLNKRNLEIVSMDKRIS
ELRDRLWKKKAALQQKENLPLPSEGQAGQHTGPSRVAAVGPYIQSSTMPRGPVRQDQLVK
PVYPDGTATLPAHDPRSHPGPGRIKTRTDDCLRQIRSQIKYKKVPSQKLNSQQLFPTQKA
STLPRMSSLSTANAEQVDDSKLKGDRKVRPFSMFEPTEVPTTSLRKNQSSDDLVRDAQSA
PKAPVKVPPPVPTKPKGPTIVPYGKTGLNTGTFPKAKPHNQQPQSAQGRSPLPPSQSQTL
PLPAKQDAPPAATVRPFTPELPSSKDSSLNKPQTLAASSIYSMYTQQPGAAKPFQPGVQG
ALNRSQSRTNGFVSVYGKPVIPSGGSPHPENPYLERRSPAPESEVDHSGANGVAPNPPEA
PQPETERIPRPLSPTKLLPFISNPYRHQSDGDLEALRKKLYNAPRPLKKRSSITEPEGPA
GPNIQKLLYQKTTLAAMETTVTTPTTPTFAGEAEKAPDDSVVPPAPSATIPVLLPIDQTK
PPPVIPESEHIIPPPPPSHPAPRFDDALFPPPPPPGLDDLPNLPPPPPEGFLEEFPPYPP
PPYPSGAEQDSLGDDTFNMKAPEITGQVTLPPGKRTNLRKPGSERIDHSMRVKFNPLALL
LDSSLEGEFDLVQRIIYEVEDPSQPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADS
DGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGV
QEKMGIMNRGMVYALWDYAGENPDELAFHEGDCMTIVRREDEDETDWWWARMGDTEGYIP
RNLLGLYPRIKPRQRTLA
Download sequence
Identical sequences H3C4A6
ENSTNIP00000003075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]