SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003078 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003078
Domain Number 1 Region: 434-676
Classification Level Classification E-value
Superfamily vWA-like 1.11e-74
Family Trunk domain of Sec23/24 0.00000533
Further Details:      
 
Domain Number 2 Region: 205-352,677-771
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.75e-67
Family beta-sandwich domain of Sec23/24 0.00065
Further Details:      
 
Domain Number 3 Region: 878-1025
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.39e-33
Family C-terminal, gelsolin-like domain of Sec23/24 0.00071
Further Details:      
 
Domain Number 4 Region: 773-877
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.71e-27
Family Helical domain of Sec23/24 0.0011
Further Details:      
 
Domain Number 5 Region: 350-433
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.7e-24
Family Zn-finger domain of Sec23/24 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003078   Gene: ENSTNIG00000016098   Transcript: ENSTNIT00000003595
Sequence length 1026
Comment pep:known_by_projection chromosome:TETRAODON8:7:8598303:8607536:-1 gene:ENSTNIG00000016098 transcript:ENSTNIT00000003595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPLSQTPPQSASPSPGPRMPPAQPTPPPPAVSSSSYYPNPQIPQAQAWQYNTALPPTF
PPNSTSTPPRGPLGNHVTPTTSSSLPPPPPSSSYSQVKTQSYALPCSDKKNSGSAPQPMT
PMASHAYQPGRAPYGPPPPGPPPAMKAAPPPPPTGPPMSSTTPLPPKADGTVAGNGPQAP
NSYNHVDNKMILMVTHYNIVGTSQPGPPGRQLGHYPSLPPGYQNTSVSHGVTAPAHPAMQ
AATQPYGPATQPYQQHGVPGPAQLSPSLAAMSLQSSTPEALRVVNLLQERNLLPPTPIPA
PTPCLPQDLQKVNCHPEVFRSTLCNIPQTQSLLNKAKMPLGLLLHPFKDLSQLPVVTSST
IVRCRSCRTYINPFVSFLDQRRWKCNLCNRVNDVPEEFMYNPVSRSYGEPHKRPEVQNAT
IEFIAPSEYMLRPPQPAVYLFILDVSHNAVETGYLNVFCQSLLDNLSRLPGDSRTKIGFI
TFDSTIHFYNLQEGLSQPQMLIVSDIEDIFLPTPDSLLVNLNECKELVQDLLKSLPTLFQ
KTMETQSALGSALQAGFKLLSPTGGRMSVFQTQLPNLGAGALQSREDPNQRASAKDVQHL
SPATDFYKKLALDCSGQQVAVDLFLLSAQYCDLASLGCISRYSAGSIYHYPSYHHQHSPA
QVECFQKDLKRYLSRKIGFEAVMRIRCSKGLSIHTFHGNFFVRSTDLLSLPNVNPDAGFA
VQMSIDENLDDIQVVSFQAALLYTSSKGERRIRVHTLCLPVVNSLSDIFAGADVQAITGL
LACMAVDRSVTSSLGDARDALTNAAIDSLSSYRQNVLTIQQPGLLSPACLRLFPLFVLAL
LKQKSFRTGTSTRLDERVFSMCQLKYQPLAYSMLMIHPSLYRVDDLTDEGALNINERTIP
QPRLLQLSVEKLSREGAFLMDAGTVIYLWIGRNCNPVFLTQVLGVPNYAAVPDNLHLLPD
LDTAESQRTRAFVGWLRQRPFFPSLHIIRDESQRKGSFMQNMIEDRTESALSYYEFLLHL
QQQISK
Download sequence
Identical sequences H3C4A9
ENSTNIP00000003078 ENSTNIP00000003078 99883.ENSTNIP00000003078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]