SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003103 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003103
Domain Number 1 Region: 227-349
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-31
Family Cadherin 0.002
Further Details:      
 
Domain Number 2 Region: 440-566
Classification Level Classification E-value
Superfamily Cadherin-like 6.94e-30
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 340-445
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-23
Family Cadherin 0.002
Further Details:      
 
Domain Number 4 Region: 124-231
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-22
Family Cadherin 0.004
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-16
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 26-109
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000228
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003103   Gene: ENSTNIG00000005148   Transcript: ENSTNIT00000001675
Sequence length 959
Comment pep:novel chromosome:TETRAODON8:1:6776942:6798900:1 gene:ENSTNIG00000005148 transcript:ENSTNIT00000001675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKRTVWKWQALWWHHFFLTWSTISAQTRYSIPEELEMGSTVGNLAKDLGLGISDIYERK
LRVASEAGKQYFSVDAGKGELVVNDRIDREALCGQSASCVLPLQVVVEKPLQLHRIEVEI
RDVNDNSPSFLKSDHVLEVAESTVVGVRFPLESAEDPDVGVNALKTYTISKDDCFTLKIK
EIENGRRVPELLLNKSLDREKKALHTLFLTALDGGSPAKSGTAKITVKVLDINDNVPVFE
NNVYKISVPENSANGSFVVSVKATDTDEGPNGEIEYSLGVHTSPSVMSLFHIDAVTGDIS
LKKQIDYETQTSYRIDVSARDKGIPKMEGHCSVQVDVVDINDNSPEIVLTSKPTSVPEDS
RSGTVVALLSVRDLDSGENGKVLLQLPKGSPFTLKPSFSNNYALVTSGVLDREKISEYNI
EVTATDSGSPPLSSRKIIPVSITDVNDNPPVFTQASYNVYLKENGLPGSILYSVSASDLD
FGENAKISYSILDSKVQEVSVSSYVYINSDNGSIYSMHSFDYEKLKVFQIQVQAKDQGSP
SLSSNASVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLLTKVTAVDADSGH
NAWVSYRLAEATDASLFTVNQYTGEVRTKRAVSEQDDSSQRLLIEIRDDGEPTQSSTVTL
SVLLEDGLHEPILDLRQKIAEPSQKSGRITLYLIVSLASVSVLSLLTFLVLAVRCIRSSR
GSGSCCMRRSDCDDYKKPNRNLQIQLNTDGPIKYVEVLGGDVMSQSQSFRSCMSPMSEYS
DFTLIKPSSTTDFKEVISVLDASLPDSTWTFESQQQKPPNNDWRFTQGQRPGPSGETGGK
TECMDRPWPQPPTEAEQLQALMATANVSEATANLGPGTMGLSTRYSPQFTLQHVPDYRQN
VYIPGSTATLTSNPQQQQATAQQAAQQALPPPQASAQPEPPKAAQTPASKKKSTKKEKK
Download sequence
Identical sequences H3C4D4
ENSTNIP00000003103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]