SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003128 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003128
Domain Number 1 Region: 304-546
Classification Level Classification E-value
Superfamily vWA-like 2.06e-76
Family Trunk domain of Sec23/24 0.00000431
Further Details:      
 
Domain Number 2 Region: 74-222,547-641
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.83e-69
Family beta-sandwich domain of Sec23/24 0.00064
Further Details:      
 
Domain Number 3 Region: 748-896
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.62e-32
Family C-terminal, gelsolin-like domain of Sec23/24 0.00078
Further Details:      
 
Domain Number 4 Region: 643-747
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 2.49e-28
Family Helical domain of Sec23/24 0.0012
Further Details:      
 
Domain Number 5 Region: 221-303
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 4.71e-24
Family Zn-finger domain of Sec23/24 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003128   Gene: ENSTNIG00000013076   Transcript: ENSTNIT00000003277
Sequence length 897
Comment pep:known_by_projection chromosome:TETRAODON8:20:3514364:3522306:-1 gene:ENSTNIG00000013076 transcript:ENSTNIT00000003277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPTTMSLLAPPPPATVNTVRCAIPVSHCQLCLFPPNFTSCSCGDTSSSSTGTASPVPNS
YDSLEGGSYPDSVPSSNNVTNQAAPYGSYGYASMQPAYQQGPAPHADPSSSQELFGQPTY
NQFPQPFPNLSQLSAALGGLSGVPELEVEALRAVNLLQERNLLPPRPLEAPEPNLSPELK
KVNCSPQTFRCTLTSIPQTQALLNKARLPLGLLLHPFRDLQQLPVITSNTIVRCRSCRTY
INPFVTFLDQRRWKCNLCYRVNDVPDEFMYNPVTRSYGEPHKRPEVQNSTVEFIASSDYM
LRPPQPAVYLFVLDVSHNAVEAGYLKFFCESLLQNLDKLPGDTRTKIGFLTFDSTIHFYN
LQEGLSQPQMLVVSDIDDIFIPCHDSLMVNLKESKELVKDLLTSLPAMFSQSTETHSALG
PALQAAFKLMSSTGGRVTVFQTQLPTLGAGALQSREDPNQRSSTKGVQHLGPATDFYKKL
ALDCSGQQVGVDLFLLSSQYADLASLSCISRYSAGCVFYYPSFHFIHNPAQLEKFQRDLE
RYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLANVNPDSAFAVQMSIEDSLA
DSSLACFQAALLYTSSKGKRRIRVHTMCLPVVNQLSDVYAGADVQAVTCLLANMAIDRSI
SSSLPDARDALLNAVVDLVGAYKSNVSNLQQSGLVLPASMCLFPVYILALLKQKALRTGT
STRLDERVFAMCEFKTQPLQQLMRMIHPDLYRLDNMSDKGALHLDDSVVPQPHLLHLSAE
RLSRDGAFLMDCGYVFYLWIGKSCSEMFIRDVLGCPDYASIPPNMSHIPELETLLSARVR
AFLDWLQDNRAFSSIVHVLKDDASATAMFFQHLVEDRSESASSYQEFLQQVQQQASK
Download sequence
Identical sequences H3C4F9
ENSTNIP00000003128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]