SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003145 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003145
Domain Number 1 Region: 49-117
Classification Level Classification E-value
Superfamily UBA-like 3.57e-25
Family TAP-C domain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 4-52
Classification Level Classification E-value
Superfamily NTF2-like 0.0000000134
Family NTF2-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003145   Gene: ENSTNIG00000000225   Transcript: ENSTNIT00000003227
Sequence length 117
Comment pep:novel chromosome:TETRAODON8:Un_random:103881105:103881765:-1 gene:ENSTNIG00000000225 transcript:ENSTNIT00000003227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YAKSRESTMAFSRVLITVPAGNSGLCIVNDQLFIRMATTEEIRRAFVAPAPTPSSSPVPT
LTASQQDMLTAFSQKSGMNLEWSQKCLQDNAWDFNAAAQVFTQLKMEGKIPDVAFIK
Download sequence
Identical sequences H3C4H6
ENSTNIP00000003145 99883.ENSTNIP00000003145 ENSTNIP00000003145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]