SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003152 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003152
Domain Number 1 Region: 419-520
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000152
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003152   Gene: ENSTNIG00000016475   Transcript: ENSTNIT00000000945
Sequence length 645
Comment pep:known_by_projection chromosome:TETRAODON8:2:14884303:14887487:-1 gene:ENSTNIG00000016475 transcript:ENSTNIT00000000945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVSDKMVCLACRCTFTNREDQMEHYKLDWHRFNLKQKLLGASPVSAEEFEKKTGAGDLSS
ISGSESDTEEGADSNHITGTENETLPESGEGSGRPCTKILFQNSAGQYLSVHRCILQGKS
AQSDGEQDAGSSLKDINKKTSWVILMTGGGHFVGAVFQGKDVLQHKTFHRYTVRAKRGTA
QGLRDSQNRSHAPKSAGAALRRYNEAALVKDIQDLLVSWSEHLQEASAVFIRAPSYNKGI
FFGGRAAPLDKKDPRIRSIPFATRRATFREAQRVHEVLSTIHVYAKDTDVSAIFSPSKKV
WKKTVKHAAQAKTDPDLGLVAAAEHQLTSEEEGDEIQLETLEVTLGTLDLRESEICPARH
QRRRRRKKEQRKTQNDEVSKTKAGNAEEDILEATTGNGTEERPSKKGADDSVEYSLRDSL
FTACKVGDIDSLHTLLQQSVSHPSAALGALLNEPVDSSGFTLLHVATAAAQKATVRLLME
AGADPACRDNKGRTPYIVAPDKDTRNVFRKYMGDNPDRYDYKKAQVPGALTVEMESKQLE
KKKAQKLLRKQRDKEHKEELKKQELEVEEKKRFASLSDREKRALAAEKRLAKQVAATGVD
IINVTRCWSCGESLLGKVPFQYSEYSFCTPRCVQAHRKANAAPGK
Download sequence
Identical sequences H3C4I3
ENSTNIP00000003152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]