SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003175 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003175
Domain Number 1 Region: 165-263
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-22
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 
Domain Number 2 Region: 24-143
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.12e-21
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 3 Region: 308-489
Classification Level Classification E-value
Superfamily vWA-like 6.39e-18
Family Integrin A (or I) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003175   Gene: ENSTNIG00000013729   Transcript: ENSTNIT00000001748
Sequence length 566
Comment pep:known_by_projection chromosome:TETRAODON8:13:12219906:12247351:1 gene:ENSTNIG00000013729 transcript:ENSTNIT00000001748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSGISMNMAFIGDADPFTAAIPATKVELTVSCRNLLDRDTFSKSDPICVLYTQGIANREW
REFGRTEVIDNTLNPDFVRKFILDYFFEERQNLRFDLYDLDCKSDNLSKHDFLGQVFCTL
GEIVGSLGGRLEKPLIGIPGKKCGTIIVRAEELSNCRESVMLQFCGNKLDKKDFFGKSDP
FLVFYRSNEDGSYTICHKTEVVKNTLDPVWQAFKIPVRALCNGDYDRSIKVEVYDWDRDG
GHDFIGEFSTSYREMSRSQSQFHIYEQEQNLLKVQESEKYQNSGTVTLLSCLVDTELSFL
DYIRGGTQINFTVAIDFTASNGNPSQPTSLHYMSPYQMNDYAMALRAVGEIIQDYDSDKM
FPALGFGAKLPPDGRVSHEFPLNGNPQNPYCSGIEGVMEAYYQSLKSVRLYGPTHFSPVI
NHVARYASAVTDGSQYFILLIISDGVITDMAQTKESIVNAASLPMSIIIVGVGPAEFDEM
VELDGDEERISSQGRYAERDIVQFVPFRDYIDRRGNHILSMARLAKEVLAEIPDQFLSYM
RTRGIKPGPLPPPYTPCPPPALHPLL
Download sequence
Identical sequences H3C4K6
ENSTNIP00000003175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]