SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003225 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003225
Domain Number 1 Region: 1861-2107
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.78e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 434-565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000165
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 850-986
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000392
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 4 Region: 283-451
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000643
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 622-751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 1109-1223
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 748-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000367
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 8 Region: 171-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000104
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 9 Region: 978-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000123
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 10 Region: 199-324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000148
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 11 Region: 594-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000261
Family EGF-type module 0.015
Further Details:      
 
Domain Number 12 Region: 559-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000732
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 13 Region: 1015-1052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 14 Region: 785-822
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 15 Region: 136-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000239
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 16 Region: 1232-1275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000911
Family EGF-type module 0.015
Further Details:      
 
Domain Number 17 Region: 98-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.028
Further Details:      
 
Domain Number 18 Region: 825-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1388-1425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000174
Family EGF-type module 0.015
Further Details:      
 
Domain Number 20 Region: 1306-1350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000495
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 1054-1096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000515
Family EGF-type module 0.021
Further Details:      
 
Domain Number 22 Region: 1527-1559
Classification Level Classification E-value
Superfamily Notch domain 0.000000222
Family Notch domain 0.0037
Further Details:      
 
Domain Number 23 Region: 1447-1478
Classification Level Classification E-value
Superfamily Notch domain 0.00000034
Family Notch domain 0.00046
Further Details:      
 
Domain Number 24 Region: 1487-1520
Classification Level Classification E-value
Superfamily Notch domain 0.000000353
Family Notch domain 0.0054
Further Details:      
 
Domain Number 25 Region: 55-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.011
Further Details:      
 
Domain Number 26 Region: 1265-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 27 Region: 1348-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000224
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003225
Domain Number - Region: 21-53
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000699
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003225   Gene: ENSTNIG00000007203   Transcript: ENSTNIT00000002659
Sequence length 2470
Comment pep:known_by_projection chromosome:TETRAODON8:4:7162495:7185745:1 gene:ENSTNIG00000007203 transcript:ENSTNIT00000002659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNRFNYQYRYYTCCLKCSLPTESCLNGGRCEANANGNGECRCPSDFVGNRCQYPSPCSPS
PCRNGGECRAVSHGNTFDFRCVCRLGFTDRLCLTPTNHACMSSPCRNGGTCELITLTAYR
CRCPPGWSGKTCQIANPCASNPCANGGQCSAFDSTYICTCPPAFHGQTCKQDVNECAQTP
SPCLNGGVCVNEVGSYHCRCPSEYTGQHCETAYMPCSPSPCQNGGTCIQKGDTTFNCICL
PGFTGEHCEHNIDDCPGHSCQNGGVCVDGVNTYNCQCPPHYTGQYCTENVDECELMPNAC
QNGGTCHDTHGSYHCVCVNGWMGDDCSENIDDCASAACYHGATCHDRVASFFCECPHGRT
GLLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPPGYTGSACNLDIDECSLGANPCEHG
GRCINTKGSFQCKCLQGYEGPRCEMDVNECMSNPCHNDATCLDQIGGFHCICMPGYEGVF
CHINIDECASQPCLNNGKCVDKINSFHCECPKGFSGNLCQVDIDECASTPCKNGAKCTDG
PNKYTCECAEGYTGQHCEIDINECYSDPCHYGTCKDGLASFTCFCRPGYTGRLCETNINE
CLSQPCKNGGTCQDRENTYVCICPKGTAGFNCEVNLDDCKSKPCDYGRCIDKINGYECAC
EPGYTGAMCNININDCAINPCHNGGTCVDGINSFTCLCPEGYNDATCLSQVDECRSNPCI
HGRCQDLINGYKCACDSGWSGPNCDINNNECESNPCMNGGTCKDMTSGYHCTCRVGFTGP
NCQTNINECASNPCLNQGTCIDDVAGYKCNCLLENIGENCETLLAPCSPRPCKNGGVCKE
AEDYQSFSCICPEGWQGQTCEIDINECVKNPCHNAAVCHNTMGGYQCQCQPGYTGLKCEI
DTDDCKPNPCSNGGLCLDGVNSFTCTCPPGFRGGRCEQDINECESNPCKNGANCTDCVNS
YTCTCPLGFSGINCEINTNDCTDSSCFNGGTCVDGINAFTCLCLPGFTGSYCQYDINECD
SKPCLNGGTCLDSYGTYKCTCPLGYTGVNCQNLVRWCDSSPCKNGGSCWQQGASYTCQCQ
TGWTGLYCDIPSVSCEVAAKQQGIDVAHLCRNSGQCLDAGSTHYCRCQAGYTGSYCQEQV
DECSPNPCQNGATCTDYLGGYSCECVPGYHGINCSKEINECQSQPCQNGGTCIDLVNTYK
CSCPRGTQGPSEGVHCEINLDDCTPFTDPLTNEPKCFNNGKCVDRIGGYQCMCLPGYVGE
RCEGDVNECLSDPCDPRGSYNCIQLTNSYRCECRTGYTGQRCDKVFDGCKGRPCRNGGTC
AVASNTPHGFICKCPPGFTGSSCEYNSRSCGALNCRNGGTCVSGHLGPRCLCPATFTGPE
CQTPTDSLCISNPCYNGGTCQITPDVPFFRCSCPSNFNGLLCHILDYSFVGGFGRDITPP
PEVEVSCEIPQCDEWAGNHICDSLCNNHACGWDGGDCSLNFDDPWQNCSAALQCWRYFND
GKCDGQCNSPGCLYDGFDCQGQEGQCNPLYDQYCKDHYADGHCDQGCNNAECEWDGLDCA
NNMPEKLADGHLVLVVHIPPEQLKNRSSAFLRELSSVLHTNVVFRRDAKGEPMVFPYYGN
EQDLVKHNVLKRSADGWPDWASMPADVLGQRKRRELDPLQVKGSVVYLEIDNRQCYQQST
ECFQSATDVAAFLGALASSGNLNVPYIEAVTRLSNGVRPTSPGSELYPMYIVFLGLAALG
FICLGVLVSRKRKREHGQLWFPEGFKVSEPSKKKRREPLGEDSVGLRPMKNSDINLMDDN
QIEWDDEDPDCRRLRLEEQAMLDLCDHGDPRKWTQQHLDAADLRIACIAPTPPQGEIEND
CMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDPSAEIITDFIYQGANLHNQTDRTGE
TALHLAARYARSDAAKRLLESSADANVQDNMGRTPLHSAVAADAQGVFQILIRNRATDLD
ARMHDGTTPLILAARLAVDGMVEELINCHADVNATDDSGKSALHWASAVNNVEAAVVLLK
NGANKDMQDNKEETPLFLAAREGSYQTAKVLLEHFANREITDHLDQLPRDIAQERMHHDI
VRLLDEYNVVRSPGLHNAPLNTSSLSPPLASPNDYLSNLKPSMSVKKVRKLTSGGKGGKD
GGKDGRNKKKKSVDGKGNLLDTSAVLSPVESLESPHGYLSDVASPPMASPFQQSPPISLN
HLQGTGDLLGMNAGKDVGCMSFDPNPPRLSHLPVSSPHSQGAASLGGSRGGQCDWVSRMH
PGVSQQGNFTQAPTMTHNIMSALHGVTTATLSQIMGYQNLQTSHLGSPAHMIQQAHSQQL
QHQNTNSNPAAGPPLNQSCPNIELNGSEMQQSNSSGHVMTIHTVMPQETQILGTQFLTPP
SQHSYSGPMDNTPNHQLQVPDHPFLTPSPGSPDQWSSSSPHSNMSDWSEGISSPPTSIHS
QVNLIPDQFK
Download sequence
Identical sequences H3C4Q6
ENSTNIP00000003225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]