SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003258 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003258
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily E set domains 8.26e-16
Family Other IPT/TIG domains 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003258   Gene: ENSTNIG00000008223   Transcript: ENSTNIT00000003422
Sequence length 927
Comment pep:known_by_projection chromosome:TETRAODON8:1:21781346:21804854:-1 gene:ENSTNIG00000008223 transcript:ENSTNIT00000003422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPARQPPLVTGISPKEGVAWTKVTIRGENLGTGPADLIGLSICGHNCLLTAEWMSASKI
VCRVGPAKDDKGEIIVTTKSGGLGTSTVSFKLLRPERIGILDQSAVWVDEMNYYDMRTNR
NKGISPLSLRPSNPLGIELDKGKIPQKDMELIFPGMSGDFTSENFSATWYLIENHSESSF
EQLKVAASNLKKQATKKNEGSLAYVKGGLSTFFEAQDALSAIHQRLESDGTERVGGSMTQ
RLENILNRASDTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VLINDYEKAKSLFCNTEVPFFNKVYSLVETRIQALRHLCYHRMLSSVCQVQCNICRYLSD
LHAPGDPAWQCICAQQKWILQLMQNCRDEFISGQRAEGHGMSVGALDLDGDTRPSALGRL
SHATSLKRGGSLRIPRSNTWHYETPQRVQFVEKLSDVVIGQLPNFWKLWISYVNGSLFSE
TGEKSGQVEKSKKNARQRQNDFKKMIEEMTHRLVKLVRGALLPTTLPKSEQNLYGGWDNK
TDLSGNWLTQIMHTVRACHEALSALEIPNDLLQVIQDLLLSLRVHCLMVTLEHTAEDVKT
LAEKEDWVVDNEGITSLPSQFEQCLVQMLQSLKEPLEVKPGEINVLQLERVQVQTTELIV
KILKVFINCLEQLSIRTDRDMDLSHDISVDLSSPDRFPGIQEGFSPTPEQRLLIILSNCQ
YLERRTILNLADHFEKHGFAGTEKITQISVEAVRQLDKNLFEAYVERRADPIAGSLEPGI
YAGYFDWRDCQTPTASGVRNYLKEALVTIITVHAEVFTVSQDLVPRVLSKIIESVADEMC
RLMQCVSSFSKNGALQARLEICALRDAVSTYLNPESIASFKLALDALPQLHSGADKKLLE
ELLNKFKSSMQLQLTCFRPCCVQPVKR
Download sequence
Identical sequences H3C4T9
ENSTNIP00000003258 ENSTNIP00000003258 99883.ENSTNIP00000003258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]