SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003269 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000003269
Domain Number - Region: 212-257
Classification Level Classification E-value
Superfamily Plexin repeat 0.000118
Family Plexin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003269   Gene: ENSTNIG00000000704   Transcript: ENSTNIT00000003307
Sequence length 403
Comment pep:known_by_projection chromosome:TETRAODON8:2:1254735:1257065:-1 gene:ENSTNIG00000000704 transcript:ENSTNIT00000003307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYYRWQSFGPTDDRTEELWVDLSSLHRSQVQIHSILSSTHRRAARVALSFDFPFYGHYLR
QITIATGGFIFMGEITHRMLTATQYVAPLMANFDPSFSNNSTVKYLDNGNLFVVQWDKVH
LKDREDEGSFTFQAALYRNGTIVFNYKDVPVPLVRINSTEHPVKVGLSDAFTAPLSPQPS
DVKQHTIYEYHRVEINTTRIVSGSAFEFTPLPTCLQHTSCELCMTSNLTTRCGWCNTLQR
CSDGIDRHRQEWLDYNCPEEAKATCEDYNPELPDTSSSSSADTHLTPTPPSSTPDDPSVT
IGMLNLQGDRRDTAAPDHNGITENTAIIAGVVAALVLLVALTLLAVYYINTHPTVAPPFD
LMQRRTNNYWPSMKFRNQGCPSGYAEVELGGHEKEGFLEAEQC
Download sequence
Identical sequences H3C4V0
ENSTNIP00000003269 99883.ENSTNIP00000003269 ENSTNIP00000003269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]