SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003292 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003292
Domain Number 1 Region: 269-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-22
Family SPRY domain 0.0006
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000228
Family V set domains (antibody variable domain-like) 0.023
Further Details:      
 
Domain Number 3 Region: 76-170
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000494
Family C1 set domains (antibody constant domain-like) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003292   Gene: ENSTNIG00000000641   Transcript: ENSTNIT00000002228
Sequence length 422
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:11198901:11200930:-1 gene:ENSTNIG00000000641 transcript:ENSTNIT00000002228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDTVTLPCWLSPEQSAEALDVQWHYDNKVDLLRYKDRIVSTPASHTGRVSFASRDAASGG
LRVGDVSLELVNVTLRDSGEYTCYVSSNQNYDSAGVALAVTETGGPLRLSALWTDGDVVN
VSCGSEGWHPEPYLSWSDPNGALTPGGVRYDRQSTGLSSVRSWLLVRSPSEIVCAVGLRG
EEEKKAKLHLNPAPAAAGLAALAALLAVAVAALGIAFCKTRGRNIRLKREIPDTEEGRNI
QLKREIPDTEEVFISLLSTVSISIPKSREPFLLMKDTPQGCVVRDRANSVPQGTKVSCLT
AIAGTPGFSSGEHRWEVSVGNDAIGPKMSWWLGVTSVRDIPENELSPTASKGYWFLASSP
ENPDFFQLSTEPAAWIPVTSRPQTVGMYLNYERGEVTFYDVQNSSVIGRLQADFEGEAFP
FF
Download sequence
Identical sequences H3C4X3
ENSTNIP00000003292 ENSTNIP00000003292 99883.ENSTNIP00000003292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]