SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003299 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003299
Domain Number 1 Region: 140-673,802-992
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-190
Family Motor proteins 0.000000064
Further Details:      
 
Domain Number 2 Region: 1623-1811
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000876
Further Details:      
 
Domain Number 3 Region: 1548-1610
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.016
Further Details:      
 
Domain Number 4 Region: 16-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000586
Family Ras-binding domain, RBD 0.019
Further Details:      
 
Domain Number 5 Region: 993-1046
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000372
Family Motor proteins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003299   Gene: ENSTNIG00000015516   Transcript: ENSTNIT00000001743
Sequence length 1955
Comment pep:known_by_projection chromosome:TETRAODON8:1:16080985:16105159:1 gene:ENSTNIG00000015516 transcript:ENSTNIT00000001743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGRPGSPNNHDSRSYLLQIYPRLVAQPTSCCNLRVHKDATAASVISDVAAVLGLDPARM
YVLAEVKESGGEEWVLEPGDLPAQRFLLWPRKAQEQHPQSLGFYFLLQERNRDGTIHYVH
LPSVAKEQEAQQLTARGFLPPPQDEFADLCNLPVLSEDSILNNLRTRFYKKKIYTYAGSI
LIAINPFMFLPIYNPKYVKMYENHQLGKLEPHIFAIADVAYYAMLRKKVNQCIVISGESG
SGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEACLIVCLSQVNFSRHFRPKPLA
LFVNTELISASRLQNCVCNTSCYVLTARNDRKHHSFYHLVLFSSAFIQGLQLNLHQQSFG
KNTINLPLSPRQQLDPHSFQQLQCCLCTVNLLIVDTNRTLPVLSSVTYCRTVVAAVRHTH
REVSRLVPSEQAVKNENRLYKVRADLNLDTETHNMLLPVNIKFIQPYSHSEAITTRDSMA
KSLYSALFDWIVLRINHALLNKKDMEESTPCLSIGVLDIFGFEDFETNSFEQFCINYANE
QLQYYFNHHIFNLEQEEYQAEGITWHNIDYTDNVGCIHLISKKPTGLLYLLDEESNFPHA
TDETLLAKFKQQHQGNKYFVPTPVMEPAFVIKHFAGKVKYQIKDFREKNTDHMRSDIVAL
LRSSDSAYVRQLIGMDPVAMFRWGILRATIRGLAAFNEAGRARAAKTSVYLGVVRPVSRT
PLGELKQSNASVDRMYKNMHAEIISSIKNLQLDGEDPRKLLQSWGRLRFPRHILQKQKHT
KHRQAIPKSLLDSRSLKFIVGLTLHDRTTKSLLHLHKKKKPPSISAQFQTSLTKLLETLN
RAEPFFIRCIRSNAQKKEMYLDEALVIQQLRYTGMLETVRIRRSGYGAKYTFQEFVNQFR
VLLPKYTKSFKEDISELLEKKMGLDPATYQIGKTKVFLKELGRQKLQDTLHKDVMRKIIF
LQRWFRARLQRKEFLDMRQAAILIQCSWRRYHKEEQRRRAATLIQAMWRGHWQRSENHRK
KQVATKIQALYRGHSARRRCQSLREEKLIARMAEEAEKSVVKEPQTREDPDIELITEEML
DDNLAVLEMEEEVNTSSHTEDKHVKGGELNDVDMELEVNGTPAEAGPQLEESQEKRELRR
LRGLEHNQRETERASSSVSGKDDTSSLKNKTQATRLKERSESKELDQYTFVAWKMKEDKT
AKKETKTSPSPAGPVRPSTLPLQPVSDRNGVSEGTGAVGLQRRPGAIKEKPEKWRGRRSD
GELSERTSPPQPHSGEEQRTKTPLHRAETALSSVDSVSPGSEGAGARQKPRGSGHQDSTQ
PIPSTPDSGVEVAVMSSAASAFIPLFCHASKEKRPHKEAQTPDNGELTLAQILSERPAGG
EAPNPGSLSWTLSQPQGDRAVKGLGRNPTIKISRATRVSEQWNASLDREITNANELRHLD
EFLGNQVNDFRTRGKSLSATESIFVTATMDFRKSIKAMYSFPYQKPTIGYKSLMSNYQNR
VIHLAGDKQKGEVKLVVNLFQSVLDGFIRGEMKKEEAEPAKPAKARKKRSKDKSMESPLD
HSFSNYQVSIMQSCDQCSSYIWAMDKAYMCTYCKMVCHKKCLCKITTDCSTFSAKKCDEE
STGQHFGVRVCHLVNDKNPVPMVLEMMLEHVEMHGLYTEGIYRKSGSANRMKELHQRLES
EPHSVCLEDYPIHTVTGLVKQWLRELPDPLMTFMHYNDFLHATDLPEKQEQLQAIYKVIE
ELPPANFITLERLIFHLVRVCKVEAHNRMSPNSLAIVFAPCVLRCPDSADPLLSMKDVAK
TTICVEMIINEQIRRYNEKMEEIDQLEYAEALAVNQLKLKRQNTHCWHLPLRFSPPYKGV
VVFCMLLLPIFPVTVHEKASSDLSVVPENEPLDSDTEAEKNLVERIKSIKQEKEDLACRL
PEMEQPGSDQENLDSETSQSSESLLDELQRSSVHS
Download sequence
Identical sequences H3C4Y0
ENSTNIP00000003299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]