SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003310 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003310
Domain Number 1 Region: 106-215
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-32
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 2 Region: 272-379
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 47-109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000189
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 219-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000216
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 2-49
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000012
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003310   Gene: ENSTNIG00000001340   Transcript: ENSTNIT00000003728
Sequence length 383
Comment pep:novel chromosome:TETRAODON8:8:3844567:3855524:1 gene:ENSTNIG00000001340 transcript:ENSTNIT00000003728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLGSYSGTTIPQLLNSTSNNLYLTFQSDMSVSAAGFHLEYTAIGLDSCPEPLSPSNGETV
GERYTVGDMVSFKCNPGFTLQGNTYITCMPGPVRRWNYPVPLCLAQCGGSLTEFSGVILS
PGFPGNYQSSLDCSWRVQLPIGFGIHLQFLNFSTEPVHDYLEVRSGSLETGTVIDRFSGP
VVPSSLFSTTHETTLFFHSDYSQNKPGFHIVYQAYELQRCPDPRPFRNGIVIGQDYSVGM
TISFECLTGYTLLGEPSLTCLHGVSRNWNHPIPRCEALCGGNITSMNGTIYSPGHPAEYP
LFQDCMWMVRVPPGYGIYINFSVINTEPIYDYITVWDGPDQASPQIGQFSGNTDQKGVST
TANQVLIKFHSDFSNSGFFVLRY
Download sequence
Identical sequences H3C4Z1
ENSTNIP00000003310 99883.ENSTNIP00000003310 ENSTNIP00000003310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]