SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003340 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003340
Domain Number 1 Region: 906-1028
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-26
Family Ankyrin repeat 0.000000254
Further Details:      
 
Domain Number 2 Region: 14-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-24
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 3 Region: 827-851,1035-1095
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-16
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003340   Gene: ENSTNIG00000008659   Transcript: ENSTNIT00000000256
Sequence length 1104
Comment pep:known_by_projection chromosome:TETRAODON8:17:5707632:5719132:-1 gene:ENSTNIG00000008659 transcript:ENSTNIT00000000256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGYTLTTLLSLARMFLTVYLSNNDQHFTEVPITPETLCRDVVELCKEPGEADCHLSEMWR
GSERAVGEGERMFDLLQRWGQHRPEVRFFLRHNRAPSRELAAGSRASEPKRNGLKGPPDR
RMENGVAPPRMDMTLAELQEMAARQQQQIEAQQQLLASKEQRLRYLKQQEQRQQQQASEQ
EKLQRLRENIDNQETRLKKVRALKGQVEQKRLSNGKLVEEIEQMNNLFQQKQRELVMAAT
KVEELNRQLELLKTSKMEHFNDNQSSVAELDRLYKELQLRNKLNQDQNSKLQQQRENLNK
RNLEIVSMDKRISELRDRLWKKKAALQQKENLPLPSEGQAGQHTGPSRVAAVGPYIQSST
MPRGPVRQDQLVKPVYPDGTATLPAHDPRSHPGPDWSSPGPESNTNGHGSASTLPRMSSL
STANAEQGRQHTHQTTLDDSKLKGDRKVRPFSMFEPTEVPTTSLRKNQSSDDLVRDAQSA
PKAPVKVPPPVPTKPKGPTIVPYGKTGLNTGTFPKAKPHNQQPQSAQGRSPLPPSQSQTL
PLPAKQDAPPAATVRPFTPELPSSKDSSLNKPQTLAASSIYSMYTQQPGAAKPFQPGVQG
ALNRSQSRTNGFVSVYGKPVIPSGGSPHPENPYLERRSPAPESEVDHSGANGVAPNPPEA
PQPETERIPRPLSPTKLLPFISNPYRHQSDGDLEALRKKLYNAPRPLKKRSSITEPEGPA
GPNIQKLLYQKTTLAAMETTVTTPTTPTFAGEAEKAPETGQMLEPENHSHISGATIPVLL
PIDQTKPPPVIPESEHIIPPPPPSHPAPRFDDALFPPPPPPGLDDLPNLPPPPPEGFLEE
FPPYPPPPYPSGAEQDSLGDDTFNMKAPEITGQVTLPPGKRTNLRKPGSERIDHSMRVKF
NPLALLLDSSLEGEFDLVQRIIYEVEDPSQPNDEGITALHNAVCAGHTEIVKFLVQFGVN
VNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCS
QFLYGVQEKMGIMNRGMVYALWDYAGENPDELAFHEGDCMTIVRREDEDETDWWWARMGD
TEGYIPRNLLGLYPRIKPRQRTLA
Download sequence
Identical sequences H3C521
ENSTNIP00000003340 99883.ENSTNIP00000003340 ENSTNIP00000001856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]