SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003344 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003344
Domain Number 1 Region: 20-174
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.78e-33
Family Ankyrin repeat 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003344   Gene: ENSTNIG00000014473   Transcript: ENSTNIT00000000161
Sequence length 338
Comment pep:known_by_projection chromosome:TETRAODON8:3:7528315:7530531:-1 gene:ENSTNIG00000014473 transcript:ENSTNIT00000000161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGLKRDLSSDEVFINRFPIHRACRDGDVGALVSMLGSLSNRTHLTVEDAFFGWTPLHW
AAHNGQLECLMRLVQMGCEVNTATSHFKHTPTHSAAMGGHADCLVWLTQAGADINRQDFL
GEAPIHKAARSGSLECTQVLLIGGAKPSLQNTSGQTAADLAYAHGFHHCFHLISKSQLRA
PSMNEGQNGNGAPCGKRLLSSVDSENSKRVRRAGGMCLVENTTSDVLAQMESGGSEEPEK
MSTDTGLELHPGGTETRACCETKAATNGHHPSMPCPEPPAPAEHSPTNMCGSLHLAESPS
RGAPHRPVWWGLTGADCEAFLHYGHYHGFGDTAEDLGD
Download sequence
Identical sequences H3C525
ENSTNIP00000003344 ENSTNIP00000017493 99883.ENSTNIP00000003344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]