SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003355 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003355
Domain Number 1 Region: 10-176,238-338
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.1e-59
Family Ankyrin repeat 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003355   Gene: ENSTNIG00000000357   Transcript: ENSTNIT00000000562
Sequence length 369
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:8726078:8730337:-1 gene:ENSTNIG00000000357 transcript:ENSTNIT00000000562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMDENTIKQLVKLVQDGKLQTLEQLITLDGSVALQTIRNKHFGRSGDTLLHYAARLGHLD
IMAYLIQVVGMDVELYNNDYKRPLHEAASMSHQDCVSYLLQEGARVDSLKKADWTPLMMA
CTRSNLAVIQDLLRHGADPVLKNKDGWTAFHIACRKGDPLVVDYLLTFAPDIWGIVSGRK
RANSAAVSAAEFAFSASLHCSSINSIWRFGAGSSPWTPAREICEANTTIMCPMCEDFEAS
PTARDRLGAQPLHQASVTGQQKALTFLVRDLNVDVNQRVNGIQLTALHYAAKEGHTSAVK
ELLELGADLHVRDRKGRSALHMACIGQHAGTAKVLLELGLRDSEDCCGTTAQQLAKKTDV
VQVFDHCLK
Download sequence
Identical sequences H3C536
99883.ENSTNIP00000003355 ENSTNIP00000003355 ENSTNIP00000003355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]