SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003359 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003359
Domain Number 1 Region: 1-446
Classification Level Classification E-value
Superfamily Sema domain 3.92e-154
Family Sema domain 0.00000000476
Further Details:      
 
Domain Number 2 Region: 449-491
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000113
Family Plexin repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 519-609
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000702
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003359   Gene: ENSTNIG00000014428   Transcript: ENSTNIT00000000387
Sequence length 803
Comment pep:known_by_projection chromosome:TETRAODON8:2:1152204:1162110:1 gene:ENSTNIG00000014428 transcript:ENSTNIT00000000387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYSTLLLEEGSGLLYVGGRGVLYALNTTNISTAAGLRIDWDASPEQKKLCLNKGRDNQTE
CYNHIRFLQRYNESHLYTCGTNAFRPLCAYIDAERFSLVSGFEEGRDRCPYDPAKGYTGL
LVDGEMFTATQYEFRSSPDVRRNFPFPTLRTEEAPTQWLLEADFVGSVLLKESINSSIGD
DDKIYFFFTERSQEQVVYPSQTKVSRIARVCKNDWGGQRTLQKKWTSFLKARMMCSVPEY
ELHLNILRSVFVLQGRDARNSIFYGIFGLEWKNIKASAICQYAFSDVQKVFDGPYMEVQD
SKWREYTGRVPEPRPGSCITDVHRSQNINTSRDLPDNVLTFARRHPLMARQVHPIGLRPL
MFKRSVNYVKIAVHQEPALDGILYTVLFLGTDDGWLHRAVDIRGEMHIMEELQLFEKAQP
VQALVISSALRSIYVSSSSGLVQVPMAACQRYASCYDCVFARDPFCGWDGKACVELASRA
QSKNSAFVQQNSAQTSAAFVETHRGLIKVRTFLKITHRKRSVMAGDDVLLQCELRSNLAS
PRWTLNGRELMGYGLNSGYRIGTDGLLIIGARAQQSGTYRCFAVENSVSVLVFLYSVRVH
TDPFFPVEPTASKFQTYRHMEAVYISLVAVLGGLCLVLTVVLLYMSFCTRLAARGRKSSQ
QGLQVLGASERKRSSHFELKTISSHCNGRQDRRSISVPTFGAMGDGFLQMVPGECQLSPA
KTPPPAPPLPMPPPLPNMDYANGLSATLPSVLRKMNGNSYVLLRQADSEGMSPLYHSFTE
ELNRILEKRKHTQLSLQPDESSI
Download sequence
Identical sequences H3C540
ENSTNIP00000003359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]