SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003363 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003363
Domain Number 1 Region: 18-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000694
Family Cadherin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003363   Gene: ENSTNIG00000000623   Transcript: ENSTNIT00000002952
Sequence length 162
Comment pep:known_by_projection chromosome:TETRAODON8:13:1860433:1868874:1 gene:ENSTNIG00000000623 transcript:ENSTNIT00000002952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSATGTGTLVIHLLDYNDNAPYVVPSVARVCEDAHDMNVAIVGGRDRDLTPNAAPFKIE
LGKQPGLDKTWKITRVNSTHSQIMLLHSLKKANYQLPLLITDSGEPPLSNSTEVKVQVCV
CKKNKMHCSSASSLRGGLLTLLATFLLPLLSCSASLVAIHLE
Download sequence
Identical sequences H3C544
ENSTNIP00000003363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]