SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003370 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003370
Domain Number 1 Region: 19-239
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.28e-83
Family Fibrinogen C-terminal domain-like 0.00000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003370   Gene: ENSTNIG00000001172   Transcript: ENSTNIT00000001543
Sequence length 241
Comment pep:known_by_projection chromosome:TETRAODON8:2:1301087:1302255:-1 gene:ENSTNIG00000001172 transcript:ENSTNIT00000001543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTMLRFALAVLLPASVRLSPLPTDCSDLYRAGSGQSGVYTIYPAGPTSPVQVYCDMSE
DRVDNSPEKWTVIQRRQDGTVNFYMKWDHYKRGFGSAAGEYWLGLETMHLLTQAKKYELR
VDMEDFDGQSVFAQYSSFAVGPEAEGYKLSLGSFVKGAAGDSLSGHNGMKFTTIDKDQDT
HASNCAQLAYGAFWHYNCFGANPNGLYTWGPSPRAHGVLWRTFKGLEQSLKTIVMKIRPA
A
Download sequence
Identical sequences H3C551
ENSTNIP00000003370 99883.ENSTNIP00000003370 ENSTNIP00000003370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]