SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003416 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003416
Domain Number 1 Region: 449-709
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.09e-91
Family Eukaryotic proteases 0.0000211
Further Details:      
 
Domain Number 2 Region: 198-306
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-23
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 311-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 98-193
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000127
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number 5 Region: 422-461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000101
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 387-418
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000589
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003416
Domain Number - Region: 347-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0851
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003416   Gene: ENSTNIG00000001040   Transcript: ENSTNIT00000001921
Sequence length 710
Comment pep:novel chromosome:TETRAODON8:6:3544346:3548054:1 gene:ENSTNIG00000001040 transcript:ENSTNIT00000001921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YHLHSGITAFSEGAEGLKAFYWSKFSAPEHVAAAVRRSRPERLQRRLPCSNKVQRCGRDQ
HSYYMEPDENVLHLLAMSFDLYAKYGNNRTLSLVSPKKPYYQWRLRVPSGHVVQLVVLTL
HGATPGSCSAHKLSAYDFLLPLQNKIIARWCGLPVSGSSPVMKLTSSGNVMLVTFSFSRQ
RDGAIFKAYFQAIPKAACGGSISSWNGSVSSPHYPSFYPPNVDCIWTVKAPLPGYLLSVT
IVALDIQDSPSSDGCEKDWLDIGGVKLCNPASHSSKKRVHSSPLLVHFHSDESLTNKGFY
LLFQAFSPEGACPRQFRCGDGRCIPLRRVCDGVKDCPDGRDEAKCSSCRPGEVMCGGRCR
PEAHPCARPGSCADSSEEGACGGKCSHACPNQPCLKRASVCDGVLDCRDRGDELNCTRAY
LKGCSSSSYKCSNGKCVNKVNPECDGVKDCPDGSDELRCRCGTRPRKRTKIVGGSDAGPG
SWPWQVSLQMERYGHVCGATLVSSRWLVSAAHCFQDSDLIKYSDARAWRAYMGMRVMTSG
SGGATIRPIRRILLHPKYDQFTSDSDIALLELSSPVAFTDLVQPVCVPSPSHTFKTGTSC
HVTGWGVLMEDGELASRLQEASVKIISRNICNKLYDDAVTPRMLCAGNLQGGVDACQGDS
GGPLVCLERGRRWFLAGIVSWGEGCARLNRPGVYTQVVKFTDWIHQQTKG
Download sequence
Identical sequences H3C597
ENSTNIP00000003416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]