SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003460 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003460
Domain Number 1 Region: 39-143
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.99e-34
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003460   Gene: ENSTNIG00000000763   Transcript: ENSTNIT00000002328
Sequence length 216
Comment pep:known_by_projection chromosome:TETRAODON8:2:3922361:3924715:-1 gene:ENSTNIG00000000763 transcript:ENSTNIT00000002328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTQSEEEHDKLGTLKEYEGERNEAGERHGGGRAVLASGDIYQGQYKNGKRHGKGTYHF
KNSSRYVGDYQQNLKHGEGIFYYPDGSRYEGSWVKDMREGHGVYTYPNGDTYEGEWLNHM
RHGQGVYHYTTTGSQYRGSWVDGKMELGGEYIHSNHRYKGNFSNNNPCGSGKFVFDIGCE
QHGEYQQIQQDTDDLEYAEPATAVKWTPVCIKPIAP
Download sequence
Identical sequences H3C5E1
99883.ENSTNIP00000003460 ENSTNIP00000003460 ENSTNIP00000003460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]