SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003464 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003464
Domain Number 1 Region: 47-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000169
Family Ankyrin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003464   Gene: ENSTNIG00000019044   Transcript: ENSTNIT00000000566
Sequence length 847
Comment pep:known_by_projection chromosome:TETRAODON8:16:5599578:5604037:-1 gene:ENSTNIG00000019044 transcript:ENSTNIT00000000566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLNTLPSCRCNCEHMAAVRHRQTLRGAGYLSSSQSARCFSMTEEHFLDAAENGNAPKVAL
MLEEVPDLNVNYVNYKGHNALQLAVANERLEITKLLLQKKELARIGDALLLAISKGYIRI
VEALLRHQAFLDGQRLSDCPSQADDDFFTYDEDGTRFSHGITPIILASQCHEFEIAHILL
MKGARIERPHDYFCQCRICSDEQSRDSFSHSQSRINAYKGLASPAYLCLSNEDPVMEALE
LGNELAVLANTEKEFKNDYKNLSMQCKDFVVDILDLCRNTEEVKAVLNGDTEACQNSDTF
CRQNLYRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGVRQQTTAVKILLVLGVAAGLP
VLAFVYWLAPSSKLGKLMRGPFLKFVAHAASFIMFLCLLVLNGIDRFGGTSLLPNMTTRD
HPLQLFRMKTTPFTWMEILITLWVIGKIWKGCNDIWEQEIREYISEPWNLLDFSILATFI
TSFLARLMAFWRAYSAQCYVNKHYSDLANVKLPFEIHYFQLARSNWLPSDPQLISEGLYA
VAVVLSFTRIAYILPANESFGPLQISLGRTVKDIFKFMVIFTTVFVAFMVGMFNLYSYYR
GVKHNNAFTTHCKPLKCVTTDSFRLKSVVININHKFIENIGYVLYGVYNIIMVIVLLNML
TAMFNSSFQEIEGDADVEWKFARAKLWFSYFEHCSTLPVPFNLIPSPNSVLSLWLGMRDF
LWNRPQSNSKENSNDELELNKVRHQADLNNKEDLSTEASLGPTHYQKIMNRLIKRYILKS
QSDKDNSQIKEGEVKEIKQDISSLHCELAERGSSDMEKLANLIRQLDEVLQKKGQKNYHK
KEQGDSV
Download sequence
Identical sequences H3C5E5
99883.ENSTNIP00000003464 ENSTNIP00000003464 ENSTNIP00000003464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]