SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003474 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003474
Domain Number 1 Region: 162-353
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-41
Family Pentraxin (pentaxin) 0.00077
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003474
Domain Number - Region: 98-143
Classification Level Classification E-value
Superfamily BAS1536-like 0.000667
Family BAS1536-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003474   Gene: ENSTNIG00000000635   Transcript: ENSTNIT00000003121
Sequence length 360
Comment pep:known_by_projection chromosome:TETRAODON8:8:8725339:8727480:1 gene:ENSTNIG00000000635 transcript:ENSTNIT00000003121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEAKATILHLRESLVQQKEMILDQRETIRELMAKLTVCEGLGRGPASHVGPGGKHGAQGD
VTSSPEQMERMLQALKERLDNMQQKRNTSLTYSNSLKELLQRKISTLEQQLHHSLDEKEH
HHRKTGFHSTKLDSMLNQLHLRATETWIFSKRKPQSPEAFQISFPVRSDYMHGRLRKTLL
QEIFALTLCLWIKAGAAPGMGTPFSYSAPGQANELVLIEWGSNPMELLVNDKAVALPLSL
SDGKWHHVCVTWSTRDGQWEAYQDGVQRGSGNNLSPWHPVKPGGVFILGQEQDALGGRFD
ASQSFVGEMSDLHLWSRVLTAGDIHSLASCGSHLQGDVLAWSEEEVELHGGVSSYPFEPC
Download sequence
Identical sequences H3C5F5
ENSTNIP00000003474 ENSTNIP00000003474 99883.ENSTNIP00000003474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]