SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003483 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003483
Domain Number 1 Region: 75-390
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-79
Family Protein kinases, catalytic subunit 0.00000218
Further Details:      
 
Domain Number 2 Region: 962-1030
Classification Level Classification E-value
Superfamily G protein-binding domain 1.39e-25
Family RhoA-binding domain 0.00047
Further Details:      
 
Domain Number 3 Region: 1242-1295
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000374
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.018
Further Details:      
 
Domain Number 4 Region: 1135-1224,1297-1335
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000626
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003483
Domain Number - Region: 768-886
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00379
Family Myosin rod fragments 0.0059
Further Details:      
 
Domain Number - Region: 536-645
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0123
Family Myosin rod fragments 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003483   Gene: ENSTNIG00000012308   Transcript: ENSTNIT00000003293
Sequence length 1375
Comment pep:known_by_projection chromosome:TETRAODON8:14:4154574:4172051:1 gene:ENSTNIG00000012308 transcript:ENSTNIT00000003293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMPGAESRQESRLSKLEALIRNPQSALNLETLLDSISALARDLNYPALRKNKNIDAFLNR
YEKAASQLQELQVKLSDFDKVKLIGRGAYGEVQLVRHKTSQKVYAMKQLNKFEMIKRSDS
AFFWEERHIMAFSNSPWVVQLCCAFQDDRHLYMVMEFMPGGDVVTLTMNYDIPEKWARFY
TAEVVLALDAIHSMGFIHRDVKPDNMLLDQHGHLKLADFGTCMKMDSTGMVHCDTAVGTP
DYISPEVLQSQGGDGFYGRECDWWSVGVFIYELLVAGETPFYAESLVGTYGKIMNHMNSL
VFPEDVEMSSDARDLICAFLTDRKVRLGRNGVEDIKRHAFFQNNQWTFDNIRETVAPVVP
ELSSDIDTTNFEDIEDDKGKAETFPPPKAFVGNQLPFVGFTYFKEDQLLEVNNKYSAEAS
KPVLYNGQLQKKLHQLEEQLDCEMQAKDELEQKYRNATNRLEKLVKELDKEMSSRQKVEA
SLRQLERDRALLQHQSAENLRKVEIETERKRGLENEQVNNLRDQLEDLRKKNQDSQMSNE
KNIQLQKQLDETNAVLQAEQEAAARMKKSQTEVQKHAQSLEASLGEMKERCSQLEKERME
LEKRLMALQAQLDEERRDRNLRTETIADLQGRIERLNEEVKEVKSSRSEVLLEKKTLQEK
FSDLQKEKNNQEIDLMFKLRTLQQSMELEELEHKATKARLADKNKIDQSIEEANSEALRE
MESALQEERSFKMQVEAKLLQLKKEHSMLDCDYKQAKQKLEELQAQKEKLSEEAKNLKLR
LEQESHKRSLSQSELKMQNQQVSVLHSSEKQLKQELNLLLDMKQTLDKQNQELRREKQEV
GGQLKELKDQLEAEQYFTTLYKTQIRELKGDCDQKSKQCKEMQRRLAEYKEERESLTAQL
EASLTKADTEQLARSIAEEQYSDLEKEKIMKELEIKDMMARHKQELGDKEATISSLEESN
RTLTVDVANLAGEKEELNNQLKEMQQKLQKAREAERQMNSLKVSFERLLQNERTLKIQAV
NKLAEVMNRRVRGGHRGNDTEVHRREKENRKLQLELRAEKEKLNSTIIKYQREMTDMQAL
LAEENQVRLELQMALDSKESDIEQLRCQLSTLSVHSLDSTSISSSNDLDTSEGYPDSRLE
GWISLPTKNTKRFGWDKKYIVVSSKKILFYNSELDREQGNPFMTLDIDKLFHVRPVTHTD
VYRADPKEIPRIFQILYANEGEIKRDQEVVMEQTPFGERAMYISHKGHEFIPTLYHFPSS
CEVCTRPLWHVFKPPPAECRRCHAKCHKDHLKKEEVIVPCKVNYDMSTAKELLLLTTSQE
EQQRWVNHLLKRIPRKHPTLSSPHMSPHRGAIKIQSARQQQTSGKTSLVSLGDPN
Download sequence
Identical sequences H3C5G4
ENSTNIP00000003483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]