SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003491 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003491
Domain Number 1 Region: 1629-1760
Classification Level Classification E-value
Superfamily C-type lectin-like 5.91e-46
Family C-type lectin domain 0.00000108
Further Details:      
 
Domain Number 2 Region: 449-558
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-41
Family Link domain 0.00076
Further Details:      
 
Domain Number 3 Region: 129-236
Classification Level Classification E-value
Superfamily C-type lectin-like 5.65e-38
Family Link domain 0.0017
Further Details:      
 
Domain Number 4 Region: 232-327
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-26
Family Link domain 0.0019
Further Details:      
 
Domain Number 5 Region: 562-657
Classification Level Classification E-value
Superfamily C-type lectin-like 1.88e-24
Family Link domain 0.0019
Further Details:      
 
Domain Number 6 Region: 1760-1819
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000162
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 14-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000463
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003491
Domain Number - Region: 765-868
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0174
Family WD40-repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003491   Gene: ENSTNIG00000003947   Transcript: ENSTNIT00000001457
Sequence length 1844
Comment pep:known_by_projection chromosome:TETRAODON8:5:12622203:12630055:1 gene:ENSTNIG00000003947 transcript:ENSTNIT00000001457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPEDVLSVSIPLEEPQRPLLGQTIFLPCYFEDHTIPDPGAPTIAPLAHRIKWSHVTKERA
TTILVALEGQVRIAEGYLDRVHLLGYPATPTDASIKLSELRSSDSGVYRCEVQHGIEDSH
DITHVHVQGLVFHYRAIMGRYSLTFEKATAACAQNSAVVASAEQLQAAFDDGFHQCDAGW
LSDHTVRYPIHDPRVNCYGDKEELPGVRTYGVRDLNETYDVYCFTEKMTGSVFHTTSAEK
FTFSEAVVACSKRGAQLANTGQLYLAWQRGMDVCNAGWLGDRSVRYPINIRRPQCGGGLL
GVRTVYLYTNQTGYPLPESHYDAFCYTGRQSLEVESSGFGEDGGDVLTVTKVTQTPEVFF
KTTTTTTEGEAVGEVETQRPTAVDFTFTESPTQKPLPQPPNLTANRGGNRAPRRWQGDRQ
ISDAPHWSVVKGSQILVNPSPSNGVLRLSTGVVFHYRSGSSRYAFTYVEAQQACQSAGAS
IATPEQLQAAYEAGYHQCDAGWLMDQTVRYPIISPRDKCAGDLGEQPGVRSYGLRPADER
YDVYCYIDGLKGEVFHLGSAEGFTYDRAAASCHEQGAVLASTGELYAAWKLGLNKCRPGW
LMDRSVRYPINNPRSECGGGRPGVHTVYAHPNQTSFPSLDSRYDAYCFRGNRLVVINGSF
PVTVNLLIIANETGLNITDIQEAILNITSISELLRPSKTLQSHRQILTISFLTSLSLVGP
PVLPPIVVETSGSGSADFGSGSASGGHSGDFSSSGVQSGSGDQVASGDLSGSGDQVTSGG
VSGSGDQVASGDLSGSGDQVTSGDLSGSGDQVTSGDLSGSGDQVTSGDLSGSGDQVTSGG
ASGSGDQVTSGDLSGSGDQVISGDLSGSGDQICLAARSASAELPSGAIRFKQHQNLSGRL
LMKKASGIDLLFTATDSVLSGDGSFSGGPQEAGEGNTGVLRIPLFGSGSGVLSGSGDVSG
SGFGSMESGSSLDTSGESGQFSGISSGFMNNQDVSGFSGFPSGFASGSGSGIFSGSGDTP
ILLLDGGLIDESIAVSQREQELGGGLLAFSGSGDISGSGTSSGDLSGSASGSGSEFFSGV
TFVGSGFTELIGSSSGEQETSGSLLYSGEYASGSGISTFISGSGSREIVSGFESSASGEG
SVTFLREDLFTQSSGDTSRSLELGQGSVEYSGEGSGSTSALHSASEDNRMFAASGTSSGL
SSADLPQVLPPSTSSEWAPTERSAGAAEALGEAVLAQVSSGAYASHSSALAPAGLAAPPT
TAAPGPVGAPGIAMETHHLQGGSNPCEPNPCGAASCSVEGNIALCQGKFPTCEFIVRVLV
RRVVAPVSCLCVGCGCLCEHAACAVRCPLSAVCMLTSAALTLNQTLICCWNRPDSPADLQ
RTQKVQPVSLEVAATTVVWTDVSFVWRDRAPRTAPPPPTPPAETVESPGPFLAEVDTLTN
AYACRATEGDAARSVRDQLQLINTNSSLSEITHQRRQASEASVPVAQQLKRTESNLNQSN
ESILLLLNPYTQIIRHPLPHVLLSKLSSQKDLVHKLIEKISLLKTKQHGTKRPVVSWCDS
GQLTLQINVGFFHSAGMPGWKPTRCSPTHQTTEASPALTAGRESEELVFITCAAAFPVVL
SSQTERVAAADEQQCEEGWTKFQGNCYLHFSDRETWLEAEQRCRDLNAHLASIITPEEQE
FVNANAQNYQWIGLNDRTVQNDFRWTDGTPLQYENWRPNQPDNYFSSGEDCVVMIWHERG
QWNDVPCNYHLPFTCKKGPASCGAPPEVENAYTFGNRREEYPVHSIIRYQCKPGFRQRHA
PVVRCRVDGQWEQPQVECTDEETYSRKIRKHKKPGRNGRTCVCQ
Download sequence
Identical sequences H3C5H2
ENSTNIP00000003491 99883.ENSTNIP00000003491 ENSTNIP00000003491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]