SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003506 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003506
Domain Number 1 Region: 27-149
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-17
Family Pentraxin (pentaxin) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003506   Gene: ENSTNIG00000001250   Transcript: ENSTNIT00000000424
Sequence length 150
Comment pep:novel chromosome:TETRAODON8:Un_random:63807845:63808658:-1 gene:ENSTNIG00000001250 transcript:ENSTNIT00000000424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCGTFLCFLQVCSGDVVCWTSEGASVRSLVFPSESSSSYVEMVPLKALSLKAFTLCMRVA
TELHGDREFILFAYRTPSYDELNVWRESDGSLSFYLSGGAVLFQVPQLGALQTHLCFTWD
SSTGAANVFMDGKKSVTKIYKKGHAIQSGG
Download sequence
Identical sequences H3C5I7
ENSTNIP00000003506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]