SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003545 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003545
Domain Number 1 Region: 817-925
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 508-611
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 618-715
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 146-262
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-20
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 710-816
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-18
Family Cadherin 0.0026
Further Details:      
 
Domain Number 6 Region: 1039-1151
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-17
Family Cadherin 0.002
Further Details:      
 
Domain Number 7 Region: 921-1035
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-17
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 1139-1247
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000131
Family Cadherin 0.0023
Further Details:      
 
Domain Number 9 Region: 394-514
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000171
Family Cadherin 0.0077
Further Details:      
 
Domain Number 10 Region: 306-392
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000143
Family Cadherin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003545   Gene: ENSTNIG00000008618   Transcript: ENSTNIT00000001256
Sequence length 1408
Comment pep:known_by_projection chromosome:TETRAODON8:17:6658830:6724063:1 gene:ENSTNIG00000008618 transcript:ENSTNIT00000001256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQGRWLIGCLGAVMAIFSLINHSWGQDTEAWSHTECKLSRPGPPATIVTIDEESPNGTV
LVENMQINGRAQDPGRTISLTLLDNYDYWVILEPGRQRLYLNSTGRVLDRDPPNYITTIV
VQVQCTNELVGTVIFHEVRIVVRDKNDNTPRFQQPRYYVAVNELTPVGTTIFTGFSGNNG
ATDIDDGPNGHIEYSILYNPNDPESNRTVSVGNTLSGYIILAERLNYEERTRYLVVVQAN
DRAPYPPNRRTATTTLTVDVLDGDDLGPMFLPCVLVNNTRDCNPLSYRAAIPEFTEPSKL
NPLNVTPLIRAVDMDRNIQPPSDRPGILYYILVGHPATYAEYFSLNKTTAELRVLQPINR
DLYQRFTLIIKAEQDNGHPLPAFADLIIEILDENNQAPYFQLATYQGYVSESSPVGATIS
ASANLTTPLEIIALDNDIEETKDPLVKITLGDYTTVFGVTQTGITRYLRLVTPVDREKQM
TYTFTMVASDGVQQSSPVTVNILVIDANDNTPTFAKVSYNVEVFTNMQPGETVLQLTAAD
ADEGLNGLVTYEILAGAQGHFIINNRTGRLTVAPGVALMVGQSYALTVKASDGAPETQRR
SSITTVYIEVLPPNNQSPPRFPLLTYSLEVSEAMRIGAILLNLQATDRENDPITYRIISG
DTQQVFNLSETIGLLILRKPLDRERTDQYRLIVTASDGNPGGTSTTTVNIVVTDVNDASG
TVSLTLFSNVYPDTKKAQLFTCLTNATDPDAGPNGQIGYRIINHPDLFLISENGSIYTKV
RLDRELQSHYDLVVEASDGAVDPRRTTLTLSIQVTDIDDNSPVFSQQNYVVNVPENSPVG
TVVLNLSATDADLVSNVTYRIRTDAARQLFSLNPITGELAVLQTLDFEDLAALGIGTSYS
FQVEAVDQGGLMPPGQATVTVRITDMNDFSPVFSQDLYKGMVAPNAEKGTVITTVLAEDQ
DPPGTPASFVRYRVDLDRSPYSGSIFDVEKETGRIVTKVNLNEEPSVTFKLFVVAFDDGE
PVKTNSTLVEITVLQPSRIPIFTQEEYRFSPVSELAPFDTPVGTVLAAAVNQTIFYSIVG
GNDLGHFQINNKTGVISTAKPLDYEAVTSYVLRVQADSMEVVMSNLRVPSKTNTAKVFIE
VQDENDHSPVFSRKLYIGGVTEDTKIFSSVLKIVATDKDTGNYSMMAYRLIIPPTQEGQD
SFVIETYTGIIKSAIMFRNMRRSYFKFQVIATDDYGTGLSSSAEVVVSGLGRVLVYVRSC
HVINIDVFLSASVCFSILERHVQDQIPGAKVIVESIGPRRHGDGFELEDYTKSDLMVYAI
DPLTNRAISPKELFKFLDGNVLEINKEFQPYLGEGGRILEIRSPDIVASVKKAAQAVGYT
EGALLALAIIIILCCIPAILIVMVTYKQ
Download sequence
Identical sequences H3C5M5
ENSTNIP00000003545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]