SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003567 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003567
Domain Number 1 Region: 84-327
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.77e-103
Family Caspase-activated DNase, CAD (DffB, DFF40) 0.000000292
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.04e-24
Family CAD domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003567   Gene: ENSTNIG00000010920   Transcript: ENSTNIT00000003442
Sequence length 346
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:3523354:3526513:1 gene:ENSTNIG00000010920 transcript:ENSTNIT00000003442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMSGKEKPVKIRSYNSSNKYGVTAKNVKELLDKGCKLLKVPPAGARICLYSDGTEFTEKY
FHTLPAHTELVLLSRGQSWSGGVSEALRRLLCTDASGDAVVKAAEDLLRDERSPKSRKVL
SDLLLNLEDRSELETRDQDADWFRGVGPWFKTKSDYMKHSCRSRIRGYTREVKSSKSIKK
AKVRKEFQKASESLEEMLKEAKYNGCYFDRSAEEEERLCTPEGWFTCQGSFDQEACSFFH
SINPYSSYESRIVFSTWNLDHRIEKRRTVIPTLLGAVERHGQARVDLGYFYQLLFTTRNL
KLVHIVCHKKEAHNLACDGRKLLRPANAVRGKKEHPAKKRRFFKKN
Download sequence
Identical sequences H3C5P7
99883.ENSTNIP00000003567 ENSTNIP00000003567 ENSTNIP00000003567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]