SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003581 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003581
Domain Number 1 Region: 1341-1471
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-28
Family Ankyrin repeat 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003581   Gene: ENSTNIG00000006600   Transcript: ENSTNIT00000001611
Sequence length 1657
Comment pep:known_by_projection chromosome:TETRAODON8:3:1104041:1121801:1 gene:ENSTNIG00000006600 transcript:ENSTNIT00000001611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDSSSAYSMNPLAALSVDRNTLVGENYRPQGGNFYPSVQPVSGEKPREAGTSVPLRYDLL
YKPDLALLDGQKSANGYAGLYKSAPPGLQKPILVPAAGGDGLGLNHQSLSSVKQSELCLT
GAGSFPRLPWISPYTDATMYPFLDMAYKASFLSQPLPFIHQQLAYQSLCGSPSGEERPFY
LSHYTPTHLSSPLGPPLRIHAATPTPAILSTLSCSQDKTLQGLGAQVPRDHSAFRTSPQV
HQAPSPQTVHLTERQHGSSGTKSTQPTSTASTLTTVHPPCSISPSQPFSRTTTDIHKPFN
RGTTSSSTSISLSHSSTAGSVNSELCSSKKTENNKTKDAGSGRSNVEKSFSPASVSLRRD
VPLKPARNAVENFLDLSAKELEGAQNGIPSKLEALAKLGYLPPSSYGLSGNQDMPIKEGV
MTPDSISTKKTDHSDKINAVSAPWAISSSSLVTSSDNRRSQILKNRNTDHQPMSQKQHGS
AKGIGNDILNYAAVGRPSELCLLPKSKVEQQRIPSSDLKKVGLNKKGEIHKSPGKHNTTS
VKLEVPEIQTRHKQKQHLSLENGTSPGQIYGDSYLPPGLAYTSRYIPYSVAENISLQHLA
TGKAPIYPQLGLLGAGFYPPRMAANHGISYGMHPNQGEVLAYPNSQSIAPPSISSLSCSD
QQEFNDKTRNSEQYKSKGRLEGDKCKKNDNEKNRPPSEMKKASGKSVAPARDDVFIDLVH
DETDRDPSPSRHLSVSTKNTDSSTKGGSGSNPIQENPEEPEPLSPLLDIPEQQTMRCART
SIQFCRRKSRALSSAGDPSGAVNQRTPAYGNVNPTSPEFNKREPNGSCGDGSASIQESNP
NPTPAEGVPDCKENQGTIIAKHTTISSGAGGNALKGVSTDVWANSSKLSREQRASQQLRR
RWKDCVTLCQGLPFGTEKLLYFSSMALKPSFHPLVSINKCERTKVWTEVFAQHLHLSHCT
FLVGTISPSSSSSQKIFGTGNSARLLENPLEIERRFRVHPVADSQPRGEGRKEPPLKTPL
RLREVSGFTEGSAGCKERAAEKKLTALIRLWKQRRELLAKEHFPQRRHTCSRSNFLPTPG
CFLTADSTLEDVKKLKVCIELNGLRLSKPHLAAELRQWWTSQPSGEGQSSAGRGQTGHLP
RGTSQKVNARSKPLRKQNRTRECAKRKWGKNWEKGQSEFQEEEFSPGFLMAPPSSPAHLQ
GSSAPQQAFASPPSSCCQDKHQKLREPQGLCGFLSSVPSLPPPSSPSPDSHPHEDDLTKP
KGKRPCKTKHTELQGKARILSVDAWRRAASFDRRRTFYVSVVAPPSSKSRNVKPPRSIRQ
ETCKQITNIAPADSTSCRPPTPLHTHPTRQIPPEVRRLIVNKNAGETLLQRAARLGYQDV
VLYCLEQQICDVNHRDNAGYCALHEACAHGWLGIVRLLVEHGADVNCSAQDGTRPLHDAV
ENDHVEVARFLLACGADPTLTSYSGRGPINMSHSATMETFLEDYLSDLQGRSEGDQGIFW
EFYGSSVFESSNGGEVYNILADPPGPDEEEDDEEDDDNRGQRARREVFEFELSDRPLLPC
YNVQVSLSQGPRNWLLLSDVLGRLRMTSRSFRRLFPQLNVQSVPEDEFYRQASLSQLLTG
PDEQELASFRPDIKDPLELVEATPELAGMLGSSLEFV
Download sequence
Identical sequences H3C5R1
ENSTNIP00000003581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]