SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003585 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003585
Domain Number 1 Region: 107-215
Classification Level Classification E-value
Superfamily Cadherin-like 7.33e-25
Family Cadherin 0.00026
Further Details:      
 
Domain Number 2 Region: 211-310
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-20
Family Cadherin 0.00083
Further Details:      
 
Domain Number 3 Region: 325-450
Classification Level Classification E-value
Superfamily Cadherin-like 5.44e-20
Family Cadherin 0.01
Further Details:      
 
Domain Number 4 Region: 22-114
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000196
Family Cadherin 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003585
Domain Number - Region: 436-479
Classification Level Classification E-value
Superfamily Cadherin-like 0.00173
Family Cadherin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003585   Gene: ENSTNIG00000007069   Transcript: ENSTNIT00000001190
Sequence length 738
Comment pep:known_by_projection chromosome:TETRAODON8:11:3211433:3260274:-1 gene:ENSTNIG00000007069 transcript:ENSTNIT00000001190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLERVKRGWVWNQFFVVEEYTGTEPLYVGKIHTDSDEGEGNIKYSISGEGAGSIFIIDE
LTGDIHATERLDREEKAFYTLRAQARDRLSNDPLEPESEFVIKVQDINDSEPKFLEGPYI
GSVAELSPIGTSVMKVTASDADDPTYGSSARVVYSVLDGEKFFTVDRHTGIIMTAVADLD
RETQDRYELVVKATDMAGQMGGLSGSTTVTIVITDVNDNPPRFPQKMYQFSVSEGAAVGT
AVGRVIATDADMGENTDMTYLIKDGGELFKVTTDAETQEAVVSIKKPLDFENKRTHNVVV
EAVNKHVDPRFVDLGSFRDQTIVRVSVSDIDEPPIFQPAEGTIMEVQEDTKVGALVGVVA
ARDPDVKNKPVRFSIDRATDQDMIFHIDPDSGAITLGKILDRETAGWHNITVKAVEADNH
TMVSHTLVSIRILDVNDNPPELATPYEASICEDAKPGQTLQTLRVYFHDDNASGKKLFIS
TAPRSGSVLGSGLVTVMDRFRSDGYFRFVCRTKTTKTVAHSSIWPISLVGFKNVQILDCA
HHADAKTQNFKRNISDTGVSTDTFSAIIFPNATVLVFVLLILTLKRHRKGQRIAEDEEDM
RDNVIKYNDEGGGEQDTQAYDMSALRNLYDFPEAKSCDSGPDIRCLPQWIQVAADFSLFK
GYIRKKVEQADADLSVPPYDSFQTYAFEGTSSPALSLSSIHTLSTTSEQDFSYLSDWGPR
FRQLAGYYAPGKQEEEGS
Download sequence
Identical sequences H3C5R5
ENSTNIP00000003585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]