SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003610 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003610
Domain Number 1 Region: 84-327
Classification Level Classification E-value
Superfamily vWA-like 7.23e-69
Family Integrin A (or I) domain 0.00000141
Further Details:      
 
Domain Number 2 Region: 1101-1284
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-39
Family Fibronectin type III 0.0000333
Further Details:      
 
Domain Number 3 Region: 1542-1631
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-19
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 4 Region: 1413-1526
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-18
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 5 Region: 958-1077
Classification Level Classification E-value
Superfamily CalX-like 9.02e-17
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 6 Region: 583-663
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000131
Family Integrin beta tail domain 0.0035
Further Details:      
 
Domain Number 7 Region: 498-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003610
Domain Number - Region: 4-36
Classification Level Classification E-value
Superfamily Plexin repeat 0.000167
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number - Region: 540-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000614
Family Integrin beta EGF-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003610   Gene: ENSTNIG00000011514   Transcript: ENSTNIT00000000519
Sequence length 1724
Comment pep:known_by_projection chromosome:TETRAODON8:2:4151449:4163913:-1 gene:ENSTNIG00000011514 transcript:ENSTNIT00000000519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLAKGCAYCTEETFNGPRCDLQENILAHGCGAAAIITAQSTMEIVKKEQINMKLQQSQVS
PQQIRMNFLPGEEKMVDVEVFAPTKGPLDLYILMDFSNSMADDLDNLKRMGNELATLVEQ
LSDDYTIGFGKFVDKVIEPQTDMRPEKLKKPWPDSDPPFSFQNVIKLTNDLNFFTAKLND
ETISGNLDAPEGGFDAILQAAVCGEKIGWRSDSTHLLVFSTESAFHYETDGVNVLSGILK
RNDEQCHLDSAGKYTEDIHQDYPSIPTLVRLLGKHNIIPIFAVTNHSYTYYQKLKEYFPI
AEVGLLQEDSSNILQVMETAFKSIRSKMSIRAENRPKAFEAQFLSAGGKLSEYGDFDFTP
GAIGKFKMRLKAQRTIDDTPVCDAAQAEKYGTMRVKPTTFTKAVNVNADVLCPACDCEKI
RVENAPRCHGNGRLVCGKCECYSGWLSTFCNCSASAALVTGQCIGPDMKEPCSGRGDCME
CGTCVCYNPEQFEGPFCEYDKTQCQRYGGFLCNDRGSCVMGKCACTEGWEGNACECPKSK
QTCLDSKGGICNGRGKCVCGLCECPNSGIELTSTCEPNFAQLGACEATRSCVQCQAWKTG
EKKDKKDCDTCPFTVVMVDELKESDKVLDSCSFRDEDDDCTYHYTVENPKDKDLEVQVLK
KKATPLDCPPASLLWLLPLLLFLLLLLALFLLCCWKYCAGCKPCCQGCLALLPCCRRGRT
VGWKEDEYLFRQSLLTSDHLDTPMVRSGPPKGTDVVRWRVTDNVHRGLNHPQAVAKPNPK
EMIPFPLSVRLDKLFFDNLARPESKEAEQLRSEVADNLNELYKQIPGAQKVQKTSFRMQR
NAGKRQDYTIADTVLSAPRSSFPDIVKLTEKNVQSGRMNNLKVVPGYYTIETDRATEAMG
AIEFQEGVESLDVHVPLFVKEEDDDKKKLQLEAVDVPLGIAKIAKRFVNITIIKDRANSI
FSFPQPAYTYSRRDGVINIPVSREIIEDGRTQVTYRTRDLTAKDKLDYVTVEGDLTYLPG
ETQKNVSVRLLELGEKDGLLEDKQPKQFVMDLSNPLVGAKLGRYQRTTITIADQPGPEIS
QKQQKGYVSPKATGPGGLLYAPSNPQAKATGPRSIQLNWEPPPGNPMGYKVKYWIYGDPE
KDAPVLDVKSPRADLTNLYPYCDYEMRVCAYNENGDGYDTDIVTCQTPEDAPGKPGRLAF
NVISPTVTQLSWAEPAETNGNITAYEVIYTPIDDELKPVGAPKKVQIDNAKKRMLLIENL
QNAQTYQYKVRAKNSVGWGPFRDASINLASQPNRPLSIPIIPDIPIVDAEAGDEYDSYLM
YSNEVLRSPTSSKSPSVSGDNPHLRSAAILFFFPPARNTLPSVTVIYRDITGVHSSPQSH
YSASSSPMSTLSSNYRAAGGSYNTEVTTTYLSGPGFTSYPSDARLSPGVPDTPSRLVFSA
LGPTALKVSWQEPHCERDIMGYCVIYQLLSGGEVKRINVTNPAENSVIIQDLLPNQSYLF
KVKAQSQEGWGPEREGVITIESAVDPRSPLCPMPGSPFTLSTPSAPGPLIFTALSPESLQ
LSWEKPRKPNGEIRGYVVTCEQLHGGGDVRTFQVHGNSAETSLTVPDLVENVPYKFKVQA
RTTEGFGPEREGIITIESQDGSALSQYNSQSMGRRDVFHMPTEVNTRTNVSHTVVNDPFH
SEGMMVTTQRTETSGMVTHQITKEVVQRSVVGGTTVTKKMFYET
Download sequence
Identical sequences H3C5U0
ENSTNIP00000003610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]