SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003614 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003614
Domain Number 1 Region: 437-545
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 232-335
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 354-444
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-19
Family Cadherin 0.0024
Further Details:      
 
Domain Number 4 Region: 4-150
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-18
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 127-244
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0057
Further Details:      
 
Domain Number 6 Region: 541-584
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000385
Family Cadherin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003614   Gene: ENSTNIG00000008618   Transcript: ENSTNIT00000002470
Sequence length 588
Comment pep:known_by_projection chromosome:TETRAODON8:17:6674889:6697776:1 gene:ENSTNIG00000008618 transcript:ENSTNIT00000002470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVRIVVRDKNDNTPRFQQPRYYVAVNELTPVGTTIFTGFSGNNGATDIDDGPNGHIEYSI
LYNPNDPESNRTVSVGNTLSGYIILAERLNYEERTRYLVVVQANAEQDNGHPLPAFADLI
IEILDENNQAPYFQLATYQGYVSESSPVGATISASANLTTPLEIIALDNDIEESLFYITL
GDYTTVFGVTQTGITRYLRLVTPVDREKQMTYTFTMVASDGVQQSSPVTVNILVIDANDN
TPTFAKVSYNVEVFTNMQPGETVLQLTAADADEGLNGLVTYEILAGAQGHFIINNRTGRL
TVAPGVALMVGQSYALTVKASDGAPETQITIEAVNEKAVSFCSNFKSVIHEDTLISENQP
ILELKATDPDAGPNGQIGYRIINHPDLFLISENGSIYTKVRLDRELQSHYDLVVEASDGA
VDPRRTTLTLSIQVTDIDDNSPVFSQQNYVVNVPENSPVGTVVLNLSATDADLVSNVTYR
IRTDAARQLFSLNPITGELAVLQTLDFEDLAALGIGTSYSFQVEAVDQGGLMPPGQATVT
VRITDMNDFSPVFSQDLYKGMVAPNAEKGTVITTVLAEDQDPPVSRNV
Download sequence
Identical sequences H3C5U4
ENSTNIP00000003614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]