SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003748 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003748
Domain Number 1 Region: 1216-1490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.88e-55
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 242-489,517-582
Classification Level Classification E-value
Superfamily L domain-like 1.28e-46
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 3 Region: 608-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.67e-17
Family G proteins 0.0053
Further Details:      
 
Domain Number 4 Region: 8-100,133-195
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000339
Family Ankyrin repeat 0.012
Further Details:      
 
Domain Number 5 Region: 1515-1760
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000061
Family WD40-repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003748   Gene: ENSTNIG00000006693   Transcript: ENSTNIT00000004171
Sequence length 1989
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:30314511:30342102:-1 gene:ENSTNIG00000006693 transcript:ENSTNIT00000004171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENIQAAYEDKQVEVARELIQQACCVECSAGVPRVGGVNLLCLAVENGDQQSVRYLLKEAR
VPVPQELCETNPAILAANSGHPNLVKELLDSVPDTEFCTAAVSNVFGQRPVSCQSGGSLP
GPCLRIDLLNWMLAKSCQHGHLDVVRLLVQRYHADVRDFAIHSDDFAVINGLPLYAAAQA
DNEAVAQFLLQNGAGFSSYMLMDHPAFSQHLLRLRIQEEPTVDGKQTVSVCWSNLQLPWL
ELDWFMDLSSRIVHLDLSSNCLVALPSVLPWGLIQLHTLDLSNNLLKELPAASTSQEVIC
TRLRQVNLSQNQLASLPSGFLHLKHIQRVSAAKNQLQTLFDIPISTNWIGLRNLQELDVS
DNCLTSLPTAVMHCLKSLSVLNVCRNRLSGVPDPWACPLKQYKASNNEIESLPDTISIFW
RTHLQEVDFSENCLKELPSYIFELEALVSLRLTGNHIVTLPATSKWKCSQLKTLDLSRNQ
LGKTQEVPKTRRLAFLTTRSRRDPDPVCSLEFPMILRDSLEVLYLNDNQLDYVPQSICGL
HSLTELYLSNNAGIRELPPELGQLSNLWQLDIENLTITNVPQEIRKEEGSVSVLAFLRAQ
LRKAEHFRRLKMLVIGPPRQGKTALLEVLQTGKAAPFTAAECSISTSTWELDNPNGGKNK
DSVTFSVWDIGGSASMSTVNQCFFTDKALFLVVWNLALGQEAVANLQTWLLNIEARAPNS
AVVIVGTHLDLIDTNFRTERLATLRAHIFALCRSPSGARATGYPDITWKHLHEVSCKTLE
GVDGLKKLIYQVASSMKDNSNTVFGNKLLGRLIPRSYLTLQKAVVAEKQKRAAQGEVQYL
TESQLQIIVEQDTGSDIRDYEDLQTAINFLIESGSLLHFPDTSHGLCTLYFLCPVWLSEC
LERITHLKSSHSVARNGVIQAEDLKMLLVGTGFTRQNEEQYFQFLAKFEIALPVANNSYL
LPHLLPHKPAVDLHGLRQQTNNTLQRLIKMSFVPAGFWERFIARMLISLKEMDLQSFEPK
RYTKNARSKPSALYTFAGTQQKNRCSTFRVRRSQTIYWKEGLLVTFDGGYLSVESSDICW
KRKKSGGIRIICQSDMRDFSAMAFITDHVHALIEQWFPALTATESDGSLLVEQYAPCPIC
ASLGHQKPAENDGGHVHYFNMEDCVLAAVENEHISCPQHVEKPVLLQELVPELFMTDFPA
RLFLEKAQLEYSEEEPHILGQGGSGTVIYQAQYGGQPVAIKRFHFKKCQKRTDVALDTMV
KHLQSADAYRSFTDFRQEAAMLRSLQHPCIVYLVGINIHPLCFALQLAPLGSLNTVLEGK
HKGSSYMPLGHMLTFKVAYQIAAGLAYLHRKSIIFCDLKSDNILVWSLEEQEAVNVKLSD
YGISRHSFHEGVLGVEGTPGYQAPEVRPGIVYDEKVDMFSYGMVLYELLTGRRPSLGHHQ
LQIAKKLSKGIRPLLGNPEEVQFFCLQTLLTECWDTKPEKRPLAVQCLRQMQQPSFPCLR
YVLSCDSHSQLFLSPLQGHSAVFWSGDKDSSRNYSVVNVEKGKMEVKRMPCPGSRISCQM
KMGSTLWMATEDQEVFIYSLKDMCPLSHPQKLLSCPAIVTCLCLVPEREKNLARVFAGMS
DGLVAVYSLLDGLPVEGEAYLCSHTLNKTMFGLKDSDPRQKPYPVKSMVLVGSGSQLWFS
NGPGVLVLDCWSLCALRRLEPYVAPSSVVSMTASFTPWDEEAVWMLDDHVNMLLFYHATS
FQLCAKYCCGDSNPLRDVFAIQREVATATAAEVKATEQEDKLEYWKSGDVTVMYAKEAGT
QIIQRQESVTDYCSISSECSLELPGSDASSMAALGSPVSTCSVSPLADLQDASGNPGQKA
PCPPEPDQDCAGPERPPCRRRRAFTVLSVNRTLWIPRREGDVLVIELQSCSNQLRGRVIA
VLSPPSYSSLGILQEAALVAHDTVVCGFLKPDMEWSLCVWRGWGSHELEVFYKSYEELGR
LETDMRRRR
Download sequence
Identical sequences H3C678
ENSTNIP00000003748 99883.ENSTNIP00000003748 ENSTNIP00000009474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]