SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003762 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003762
Domain Number 1 Region: 974-1046
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.03e-18
Family TB module/8-cys domain 0.00078
Further Details:      
 
Domain Number 2 Region: 2362-2434
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-18
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 3 Region: 554-680
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.26e-18
Family Growth factor receptor domain 0.0071
Further Details:      
 
Domain Number 4 Region: 2477-2605
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 5 Region: 1877-2013
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 2159-2285
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 330-400
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.84e-17
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 8 Region: 1050-1180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 9 Region: 184-269
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.36e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 10 Region: 1714-1780
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000131
Family TB module/8-cys domain 0.0008
Further Details:      
 
Domain Number 11 Region: 2079-2142
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000155
Family TB module/8-cys domain 0.00014
Further Details:      
 
Domain Number 12 Region: 1552-1627
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000235
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 13 Region: 674-747
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000249
Family TB module/8-cys domain 0.00092
Further Details:      
 
Domain Number 14 Region: 870-953
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000523
Family TB module/8-cys domain 0.0027
Further Details:      
 
Domain Number 15 Region: 1154-1265
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000785
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 16 Region: 468-594
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000122
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 17 Region: 1342-1478
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000141
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 18 Region: 1635-1683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000093
Family EGF-type module 0.00085
Further Details:      
 
Domain Number 19 Region: 2433-2487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000466
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 20 Region: 1264-1318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000131
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 21 Region: 2037-2084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000188
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 22 Region: 737-872
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 23 Region: 1794-1844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000023
Family EGF-type module 0.0026
Further Details:      
 
Domain Number 24 Region: 2602-2717
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000455
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 25 Region: 2316-2364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000155
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 26 Region: 2002-2039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000913
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 27 Region: 1478-1562
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000973
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 28 Region: 289-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 29 Region: 1838-1873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000513
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 30 Region: 1676-1719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000617
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 31 Region: 2276-2322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000033
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003762
Domain Number - Region: 155-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000164
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003762   Gene: ENSTNIG00000009530   Transcript: ENSTNIT00000002027
Sequence length 2898
Comment pep:known_by_projection chromosome:TETRAODON8:5:10108510:10147354:-1 gene:ENSTNIG00000009530 transcript:ENSTNIT00000002027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCRGRLLQLAVALVTLLSLRAELREAAEAGDPEASELVTKAMDPRASRAKRRGGADVLRG
PNVCGSRNNAYCCPGWKTLTGGNQCIVPICRSSCGDGFCSRPNMCTCPTGQTALSCGSKS
VQNCNIRCMNGGTCAEDHCLCQKGYIGKHCGQPVCENGCLNGGRCVAPNRCVCPYGFTGA
QCERDYRTGPCFASVDNQVCQGQLTGIVCTKTLCCATVGRAWGHPCEMCPAQPNPCRRGF
IPNHRTGACQDVDECQAIPGICQGGNCINTVGSFECKCPAGHRFSELSQKCDDLDECSNI
PGLCGVGECSNTIGSYFCKCPQGYFTSMDGSRCIDIRSGYCYTSVLNGRCANQNSQLMSK
IQCCCDSGRCWADGSLPEMCPIPGTEEYRKLCIQFPDGTNGVLIPGRVPGGPELPGIYPV
QYPGHTPGVVPGQVPGVIPGQIPIPGQIPGQFPGHLPLQPPPVPGTQNITNLCQAYRNLC
QNGRCIPVPGEIRYRCECNMGYRLNGRGECFDDDECERNPCAHGECVNTPGSYICQCPAG
FQSTSTRTECRDLDECVANGRICNNGRCVNTEGSFHCVCNAGFEISADGKNCQDQDECLI
RNMCLNGLCINEDGSFKCICKPGYLLDSSGRMCIDIDECETPGMCMNGRCINTEGSFRCE
CMAGMAVGLDGRVCVDTHMRSSCYGGYKRGQCVRPLFGAVTKSECCCASTEYAYGEPCQP
CPPQNSAEFLALCPNSIGTTGDGRDINECALDPDICQNGVCENMLRTYKCTCNEGYEVDL
SGKSCIDIDECLINRLLCDNGLCRNTPGSFSCQCPKGYAFNPKTDVCEVSPDVNECQSNP
CINGECKNSQGSFVCLCSMGSSLDSSGLECIETIKSVCWLKIINNRCEVNINGATLKSHC
CATLGEAWNSPCSKCEKDAICSKGFARVRGNLCEDVDECQVFPGVCINGKCINTPGSFFC
QCPPGMTVDVSGRMCIDLRTEHCYLTHEDERCGAPISGRHRVDACCCSVGVAWGPECDEC
PERGSPEYEQLCPRGPGFSHRGDFLNGRPFLKDINECRMINTLCSNGRCRNTIGSFRCRC
DNGYALDADERNCTDIDECRISVDICGPGRCVNTPGDFECECFEGYESGFMMMKNCMDID
ECERNPLLCRGGDCVNTEGSFQCVCPMGHEIAPDGSACLDINECELSDRLCRNGQCINMI
GRYQCACDTGYKSTESRVECVDIDECTIENGGCETFCTNSEGSYECSCHSGYALLPDLRS
CTASDIDECVESPDICDGGQCTNTPGMYQCLCFDGFMSSDDMKTCLDVDECELNSNICLS
GNCENTKGSFICHCDMGYSVRKGTTGCTDINECEIGAHNCHRHATCTNTAGSFKCDCAPL
WIGDGITCADLDECSNGTHKCNNNAECQNTMGSYRCTCKEGFSGDGFYCSDSDECAENSD
LCDNGNCLNLPGGYRCECDMGFIPTVDGKACEADIDECTFSDICVNGRCHNIPGLFRCEC
NPGYELDRTGGNCTDVNECADPTFCINGICVNNAGSYLCQCPVDFQLNPTGVGCVDTRSG
SCFLDVRSRGDSSESLDCSNEIGVGVAKASCCCSQGKGWGSPCEPCPSGNSTEYKTLCPG
GEGFRPNPITVILEADINECQELPGLCQGGKCINTFGSFQCECPRGFTLNTDTRVCEDVN
ECEQPGICGPGKCYNTIGNYTCICPVDYMQVNGGNNCMDMRKSYCYRNFYSDNNTCDGEL
TFNMTKKMCCCSYNIGRAWNKPCEQCPLPSTEEFTFLCGSERPGYYIDIITGRVIDIDEC
REIPGVCENGLCINMIGSFRCECPIGFIYNDKLLICEDIDECQNGPVCQQNAACLNLPGS
FRCDCKPGYRFTSIGQCLDRNECMENPGICNPGQCIDTLGSYRCICPNGFKVTRDQSMCV
DVDECEKQPCGNGTCKNTVGSYNCLCYPGFQNSHNSDCIDVDECAVQRGLCRNGQCVNTI
GSFLCECNEGYELTQDGRLCADINECAINPSTCGPGTCLNLDGSYRCICPPGYYLHEETC
KDIDECSQLPEICTFGTCSNTVGSFTCLCFPGYQISASGRTCIDFRVNYCYTKFENGRCQ
APKPQNTTKEVCCCTGMPGQGWGDPCEICPSKGEEAYPHLCRKEGYQQGRDEKPKADVDE
CLNDPCINGQCINTDGSFRCECPMGYQLDISGVTCEDTNECSTGNPCGNGTCTNAIGGFE
CACDDGFEPGSMMTCEDINECAQNPLLCAFRCVNVVGSYECKCPTGYVLREDRRMCKDQN
ECEDGIDDCASRGMSCKNLIGTYMCICSPGYTRQPSGDGCMDLNECAAKPGICKNGRCEN
TVGSYRCKCDQGFVANPTQTECIDNREGFCFTEVLTTLCQMSSSNRNMVTKAECCCDGGR
GWGTSCELCPLPGTTQYKKMCPLGPGFTTDGRDIDECRVMGNLCKNGQCINTLGSYSCTC
KPGYTTDITGAVCVDVDECIQAPKPCNFICKNTEGGYLCSCPRGYILQEDGKSCKDLDEC
SSKQHNCQFLCVNTIGGFTCKCPPGFTQHHSACIDNNECATDPSLCGSNGVCQNTPGSFS
CDCQRGFSLDPSAQTCEDMDECDGNHRCQHGCQNLVGGYRCSCPGYLQHYQWNQCVDENE
CLNAQICGGASCHNTLGSFRCLCPTGFNYEQGGGGCADINECSTSQNPCKFGCSNTDGGY
LCGCPPGYYRAGQGHCVTGLGFGSSSGGPGQEGEGDDNSLSPEACYECKINGYPKKGRQR
RSANSTHEEDVQLTEEVSLASVDIEDTLQFHLNLSDLSNRDHILEFTPALSTLSDHVRYS
IDLGNDEGYFKINQRDGVSYLHLSRKKSLPPGAYLLQISSMPLYRKKELSEMEDQHDKDY
LTGQLGEILRMRVQIILH
Download sequence
Identical sequences H3C692
ENSTNIP00000002847 ENSTNIP00000003762 99883.ENSTNIP00000003762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]