SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003797 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003797
Domain Number 1 Region: 208-345
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-37
Family Third domain of FERM 0.0035
Further Details:      
 
Domain Number 2 Region: 107-210
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-29
Family Second domain of FERM 0.0000764
Further Details:      
 
Domain Number 3 Region: 21-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-27
Family First domain of FERM 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003797   Gene: ENSTNIG00000006009   Transcript: ENSTNIT00000002583
Sequence length 603
Comment pep:known_by_projection chromosome:TETRAODON8:12:7672017:7702581:1 gene:ENSTNIG00000006009 transcript:ENSTNIT00000002583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRMKMLRFRSPSSRSLDQEVLCTIRLLDDSEISCSIQRDTRGQFLLDHVCNHYNLLEKDY
FGIRYVDPEKQRHWLEPNKPVARQMKLAQQPFTMCFRVKFYPSEPMKIKEELTSRYLLYL
QLKRDIYHGRLLCPFAEAAYLGACIVQAELGDYDPEEHPSDYIRDFKLFPKQSLKLERKI
IETHKNELRGQCSALAELNMLQRAHSLETYGVDPHPCKDFTGSTAFLGFTAKGFVVFQGN
KRIHLLKWTDVSKLKFEGKTFYVIGIQKEKKLVLTFHTSTPAACKHLWKCGVENQAFYKC
AKSSQIKTVCSSNIFFKGSRFRYSGRVAKEVIEASSKIQREPPQVCTVQFGQSRSFNSLS
HKNLIMNMEPLVPALPSTNECEDAAGDNERDQPLAKHTRTSSALLSRSPIFLMQTFKDTP
KAEVDLEDGDEASSPLTISELAYSPCASMLPTPISDSQRGVDLLFSSPVQSPARMLRELH
ADPEIQARLEAEREQDRAYERTCQAARGHAGGLLSGSLRLLSSNERVNACLLSVARFVAV
VMGILLVTVPTLLLLLESDIDVSFLHEIRQTPEFEQFHYEYYCPLRRWILCKISLAMENL
WSD
Download sequence
Identical sequences H3C6C7
99883.ENSTNIP00000003797 ENSTNIP00000003797 ENSTNIP00000003797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]