SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003800 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003800
Domain Number 1 Region: 137-313
Classification Level Classification E-value
Superfamily E set domains 5.13e-63
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000392
Further Details:      
 
Domain Number 2 Region: 30-149
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-16
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003800   Gene: ENSTNIG00000000371   Transcript: ENSTNIT00000000283
Sequence length 338
Comment pep:known_by_projection chromosome:TETRAODON8:7:10707891:10708907:-1 gene:ENSTNIG00000000371 transcript:ENSTNIT00000000283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGSTAERRIVSKDGHNNVRIDNVEGMVKLYLHDIWTTVVDMKWRYKLTLFASTFVLTWF
IFGVIFYFIGMGNGDYQAGSNSTHTPCVTNVETLTGAFLFSLESQTTIGYGFRYISEECP
LAIFTLVAQLVITGLAEIFVTGAFLAKLARPKKRSETIKFSQVAVICRRQGKLCLMVRVA
NMRKSLLIQCQLTGKLLHPSVTQEGEKTLVHQSPVDFYMDSSGDCPFLILPLTFYHVLDE
HSPLAGLNARNLRRHDFELLVTLNATMESTAATCQSRTSYIPQEILFGYEFRPVLFSTTG
GRYVADFNFFDKVQLSSDSGFHSNDKEKLQLEEDYKKE
Download sequence
Identical sequences H3C6D0
99883.ENSTNIP00000003800 ENSTNIP00000003800 ENSTNIP00000003800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]