SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003808 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003808
Domain Number 1 Region: 36-75
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000173
Family HIT zinc finger 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003808   Gene: ENSTNIG00000000440   Transcript: ENSTNIT00000003659
Sequence length 185
Comment pep:known_by_projection chromosome:TETRAODON8:1:20968320:20976792:-1 gene:ENSTNIG00000000440 transcript:ENSTNIT00000003659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSVIFPKTDIVSTTEGPVETSGQDEEPKTKKRKISLSNCSVCGLHEAKYKCPGCLVHSC
SLPCVKKHKADSSCSGIRNKTAFVALSQFDEMALLSDYRFLEDTGRFADGATRDSLVQTP
RTTSKAKQAVSLCQKDEHHPEVPSCLLHQEQGKFHFFPDKRENISVAPKACFPSEQHRVQ
PEEGF
Download sequence
Identical sequences H3C6D8
99883.ENSTNIP00000003808 ENSTNIP00000003808 ENSTNIP00000003808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]